close

SimulationCraft 603-19

for World of Warcraft 6.0.3 Live (build level 19243)

Table of Contents

Raid Summary

 

DPS Chart DTPS Chart
HPS Chart TMI Chart
Ciaran

Ciaran : 20262 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR   HPS HPS(e) HPS Error HPS Range HPR
20262.2 20262.2 8.8 / 0.043% 2760.5 / 13.6% 36.3       128.0 128.0 5.89 / 4.60% 1904 / 1486.9% 0.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
553.6 553.6 Mana 0.25% 36.3 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Ciaran/advanced
Talents
  • 15: Feline Swiftness
  • 30: Ysera's Gift
  • 45: Typhoon
  • 60: Force of Nature
  • 75: Incapacitating Roar
  • 90: Nature's Vigil
  • 100: Balance of Power
  • Talent Calculator
Glyphs
  • Glyph of Guided Stars
  • Glyph of Rebirth
  • Glyph of Stars
  • Glyph of the Chameleon
  • Glyph of the Stag
Professions
  • leatherworking: 35
  • skinning: 289

Charts

http://8.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Ciaran+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x120&chd=t:30371|15432|11512&chds=0,60741&chco=8AD0B1,69CCF0,ABD473&chm=t++30371++starsurge,8AD0B1,0,0,15|t++15432++starfire,69CCF0,1,0,15|t++11512++wrath,ABD473,2,0,15& http://9.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Ciaran+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:34,20,20,13,12,2,1&chds=0,100&chdls=ffffff&chco=69CCF0,ABD473,8AD0B1,69CCF0,ABD473,C79C6E,ABD473&chl=starfire|wrath|starsurge|moonfire|sunfire|shattered_bleed|treant: wrath&
http://1.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Ciaran+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:abgimrty036468567512yzvvrnniigfffeeddcbaaaaYaaabcaZZaZZaaacbbcbccbaaabcaabbaZYYYXYYYYYZaaZYZaZZabbbbcbbbbbaZZabbabbaZZZZZZZZZabccbbbbabccdcddddddcbaabcbbcbbaaaZZZZZYZabbaZaaZaaccdefggijkklnoppppppoonmljigggfddccbabaZZZZYZaaaaaabaaaababbbbbcbaZaaaaZaaaZZaZZZZZZabbcbbcccbcccccdcccccbaaaaaaaaZZZZZYZZZYZaabaabbbabbbbbbbbbbbaZZaaZZaZZZZZZYZZYYZaaaaaabaaabaaaaaaaaaZYYXVTSRPNMLK&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.503413,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=20262|max=40250&chxp=1,1,50,100 http://4.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Ciaran+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:3,4,8,26,33,58,88,134,230,351,425,573,687,866,1067,1201,1311,1510,1473,1485,1525,1557,1509,1328,1219,1087,994,844,702,626,450,424,297,246,212,133,104,67,40,31,22,21,13,3,5,2,4,0,1,1&chds=0,1557&chbh=5&chxt=x&chxl=0:|min=17957|avg=20262|max=23478&chxp=0,1,42,100& http://0.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Ciaran+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:43.8,35.7,13.0,3.6,3.4,0.3&chds=0,100&chdls=ffffff&chco=69CCF0,ABD473,8AD0B1,ABD473,69CCF0,ffffff&chl=starfire 131.8s|wrath 107.4s|starsurge 39.1s|sunfire 10.8s|moonfire 10.3s|waiting 0.8s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Ciaran 20262
moonfire 2532 12.5% 9.0 34.97sec 84448 73681 Direct 9.0 4806 9118 5358 12.8% 1.8 1610 3158 12.4%  
Periodic 175.7 3330 6763 3773 12.9% 40.3 1004 2037 12.9% 98.9%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 9.00 175.72 175.72 1.1462 1.6945 760316.04 760316.04 0.00 2467.92 73681.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.23 12.37% 3157.81 2061 7721 638.73 0 7721 716 716 0.00
multistrike 1.61 87.63% 1609.84 1031 3860 1301.02 0 3860 2584 2584 0.00
hit 7.85 87.20% 4806.10 0 12868 4765.10 1957 7738 37735 37735 0.00
crit 1.15 12.80% 9117.54 0 25736 6400.86 0 25736 10503 10503 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 5.2 12.95% 2037.07 1194 6134 2029.09 0 6134 10626 10626 0.00
multistrike 35.1 87.05% 1003.71 597 3067 1005.65 731 1486 35202 35202 0.00
hit 153.1 87.10% 3329.92 80 10223 3336.35 3090 3633 509648 509648 0.00
crit 22.7 12.90% 6762.57 196 20446 6778.50 4663 10148 153303 153303 0.00
 
DPS Timeline Chart
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A Lunar spell that burns the enemy for {$164812s1=1 + 40.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=20 seconds}.{$?s79577=false}[ Upon reaching 100 Lunar Energy, your next Moonfire within {$171743d=5 seconds} will deal {$171743s1=100}% additional initial damage.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.292500
  • base_td:0.00
  • dot_duration:40.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
shattered_bleed 385 1.9% 17.4 17.53sec 6637 0 Direct 17.4 1617 3250 1826 12.8% 4.0 485 976 12.9%  
Periodic 97.3 784 0 784 0.0% 22.3 238 0 0.0% 32.3%

Stats details: shattered_bleed

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.41 17.41 97.32 97.32 0.0000 1.0000 115548.59 115548.59 0.00 1187.29 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.51 12.87% 975.72 952 1142 391.81 0 1142 502 502 0.00
multistrike 3.48 87.13% 485.00 476 571 468.90 0 571 1690 1690 0.00
hit 15.18 87.21% 1616.55 1586 1904 1616.72 1586 1745 24545 24545 0.00
crit 2.23 12.79% 3250.04 3173 3807 2914.01 0 3807 7238 7238 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike 22.3 100.00% 237.96 238 238 237.96 238 238 5318 5318 0.00
hit 97.3 100.00% 783.56 1 793 783.83 750 793 76257 76257 0.00
 
DPS Timeline Chart
 

Action details: shattered_bleed

Static Values
  • id:159238
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:159238
  • name:Shattered Bleed
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2.
  • description:Inflicts {$s1=1500} Bleed damage, plus an additional $o2 damage over {$d=6 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1499.91
  • base_dd_max:1499.91
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:749.87
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
starfire 6791 33.4% 52.6 5.61sec 38675 15432 Direct 52.6 31792 65195 36182 13.1% 12.1 9534 19542 13.1%  

Stats details: starfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.59 52.59 0.00 0.00 2.5062 0.0000 2033889.52 2033889.52 0.00 15431.75 15431.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.59 13.13% 19542.48 10846 28998 15553.16 0 28998 30997 30997 0.00
multistrike 10.50 86.87% 9534.15 5423 14499 9554.91 6350 14499 100092 100092 0.00
hit 45.68 86.86% 31791.68 17572 48331 31858.82 28034 35679 1452133 1452133 0.00
crit 6.91 13.14% 65195.23 35144 96661 65342.59 0 96661 450668 450668 0.00
 
DPS Timeline Chart
 

Action details: starfire

Static Values
  • id:2912
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:960.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(eclipse_energy>=0&eclipse_change>cast_time)|(eclipse_energy<0&cast_time>eclipse_change)
Spelldata
  • id:2912
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:A Lunar spell that causes {$s1=1 + 187.2%} Arcane damage to the target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.340000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
starsurge 3960 19.5% 30.7 10.02sec 38705 30371 Direct 30.6 31998 65474 36369 13.1% 7.0 9597 19623 13.2%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.70 30.57 0.00 0.00 1.2744 0.0000 1188398.83 1188398.83 0.00 30370.53 30370.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.93 13.18% 19623.20 14891 27881 11854.77 0 27881 18182 18182 0.00
multistrike 6.10 86.82% 9597.26 7444 13941 9587.79 0 13941 58579 58579 0.00
hit 26.57 86.94% 31998.09 24812 46469 32042.38 29198 36082 850313 850313 0.00
crit 3.99 13.06% 65474.41 49624 92937 64429.87 0 92937 261324 261324 0.00
 
DPS Timeline Chart
 

Action details: starsurge

Static Values
  • id:78674
  • school:spellstorm
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:960.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.lunar_empowerment.down&eclipse_energy>20
Spelldata
  • id:78674
  • name:Starsurge
  • school:spellstorm
  • tooltip:
  • description:Instantly causes {$78674s1=2242} Spellstorm damage to the target, benefiting from your strongest current Eclipse bonus. Also grants Lunar or Solar Empowerment, based on current Balance Energy side, which increases the damage of your next $164547n Starfires or $164545n Wraths by {$164545s1=30}%. Max 3 charges. Charges shared with Starfall.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.925000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
sunfire 2352 11.6% 9.5 32.33sec 74143 65451 Direct 9.5 7039 14285 7946 12.5% 2.0 2349 4661 12.9%  
Periodic 169.3 3051 6227 3459 12.9% 38.8 917 1868 12.9% 96.1%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.53 9.53 169.27 169.27 1.1329 1.7088 706933.60 706933.60 0.00 2356.05 65450.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.26 12.89% 4660.60 2061 5239 1054.57 0 5239 1193 1193 0.00
multistrike 1.73 87.11% 2349.09 1031 2619 1964.84 0 2619 4064 4064 0.00
hit 8.34 87.48% 7039.46 0 8731 7021.42 4056 8731 58717 58717 0.00
crit 1.19 12.52% 14284.83 0 17463 10267.55 0 17463 17049 17049 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 5.0 12.92% 1868.10 1194 4162 1857.94 0 4162 9373 9373 0.00
multistrike 33.8 87.08% 916.56 597 2081 917.97 725 1214 31003 31003 0.00
hit 147.5 87.15% 3050.74 22 6937 3055.06 2853 3338 450032 450032 0.00
crit 21.8 12.85% 6227.44 2827 13873 6238.94 4702 8763 135503 135503 0.00
 
DPS Timeline Chart
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1056.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<7|buff.solar_peak.up
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every {$t2=0} seconds.
  • description:A Solar spell that burns the enemy for {$164815s1=389} Nature damage and then an additional $164815o2 Nature damage over {$164815d=24 seconds}{$?s33605=false}[to the primary target and all enemies within $164815A2 yards][]. Upon reaching 100 Solar Energy, your next Sunfire within {$171744d=5 seconds} will deal {$171744s1=100}% additional initial damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.405000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.292500
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
wrath 4095 20.3% 61.7 4.26sec 20034 11512 Direct 61.4 16777 33583 18838 12.3% 14.1 5030 10085 12.2%  

Stats details: wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.69 61.39 0.00 0.00 1.7404 0.0000 1235960.05 1235960.05 0.00 11511.54 11511.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.72 12.23% 10084.61 6865 12297 8200.87 0 12297 17359 17359 0.00
multistrike 12.35 87.77% 5029.79 3432 6749 5032.33 3868 6112 62120 62120 0.00
hit 53.86 87.73% 16776.58 11441 23754 16783.36 15145 18802 903573 903573 0.00
crit 7.53 12.27% 33582.90 22883 44974 33569.74 0 40988 252909 252909 0.00
 
DPS Timeline Chart
 

Action details: wrath

Static Values
  • id:5176
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1120.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(eclipse_energy<=0&eclipse_change>cast_time)|(eclipse_energy>0&cast_time>eclipse_change)
Spelldata
  • id:5176
  • name:Wrath
  • school:nature
  • tooltip:
  • description:A Solar spell that causes {$s1=1121} Nature damage to the target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.462500
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - treant 207 / 149
wrath 207 0.7% 102.3 3.13sec 436 205 Direct 101.9 362 728 409 12.8% 23.4 109 219 12.8%  

Stats details: wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 102.29 101.85 0.00 0.00 2.1303 0.0000 44573.62 44573.62 0.00 204.54 204.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.99 12.81% 218.65 211 259 207.50 0 259 655 655 0.00
multistrike 20.37 87.19% 108.73 105 130 108.77 105 119 2214 2214 0.00
hit 88.76 87.15% 362.44 351 432 362.58 357 373 32171 32171 0.00
crit 13.09 12.85% 728.45 703 863 728.80 703 863 9533 9533 0.00
 
DPS Timeline Chart
 

Action details: wrath

Static Values
  • id:113769
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:0.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113769
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Causes {$s1=180} Nature damage to the target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.187500
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Healing and Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% Up%
Ciaran 128
yseras_gift 128 100.0% 0.0 0.00sec 0 0 Periodic 43.7 880 0 880 0.0% 72.6%

Stats details: yseras_gift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 0.00 0.73 43.70 43.70 0.0000 5.0000 38451.19 427180.15 91.00 175.98 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.63 86.39% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.10 13.61% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.7 100.00% 879.79 0 9775 645.72 0 9641 38451 427180 66.59
 
HPS Timeline Chart
 

Action details: yseras_gift

Static Values
  • id:145108
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ciaran
  • harmful:false
  • if_expr:
Spelldata
  • id:145108
  • name:Ysera's Gift
  • school:nature
  • tooltip:
  • description:Heals you for {$s1=4}% of your maximum health every $t sec. If you are at full health, a random nearby injured ally will be healed instead.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:720.00
  • base_tick_time:5.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Ciaran
celestial_alignment 2.0 181.76sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.01 2.01 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.75 86.84% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.26 13.16% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: celestial_alignment

Static Values
  • id:112071
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:eclipse_energy>40
Spelldata
  • id:112071
  • name:Celestial Alignment
  • school:physical
  • tooltip:Balance Energy cycle paused. All Lunar and Solar spells benefit from your maximum Eclipse bonus. Damage dealt increased by {$s2=20}%. Your Moonfire and Sunfire spells to also apply the other's damage over time effect.
  • description:You enter Celestial Alignment, a state where your Balance Energy cycle is paused, and all of your Lunar and Solar spells benefit from your maximum Eclipse bonus. Also increases your damage dealt by {$s2=20}%, and causes your Moonfire and Sunfire spells to also apply the other's damage over time effect. Lasts {$d=15 seconds}.
 
draenic_intellect_potion 2.0 0.00sec

Stats details: draenic_intellect_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156426
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156426
  • name:Draenic Intellect Potion
  • school:physical
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
 
force_of_nature 16.8 19.74sec

Stats details: force_of_nature

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.78 16.78 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.67 87.42% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.11 12.58% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: force_of_nature

Static Values
  • id:33831
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:trinket.stat.intellect.up|charges=3|target.time_to_die<21
Spelldata
  • id:33831
  • name:Force of Nature
  • school:nature
  • tooltip:
  • description:Summons a Treant which will immediately root your current target for {$113770d=30 seconds}. The Treant will cast Wrath at that target for {$113769s1=180} Nature damage every 2 sec. Lasts {$d=15 seconds}. Maximum 3 charges.
 
moonkin_form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.89 89.25% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.11 10.75% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:2976.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Arcane and Nature damage done increased by {$24905s2=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=true}[Astral Form][Moonkin Form], increasing Arcane and Nature damage you deal by {$24905s2=10}% and increasing your armor by $m3%. Grants {$24907s1=550} Mastery to all party and raid members within $24907a1 yards. The act of shapeshifting frees the caster of movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 25.01% 0.0(0.0)

Buff details

  • buff initial source:Ciaran
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
celestial_alignment 2.0 0.0 181.8sec 181.8sec 10.15% 18.62% 300.2(300.2)

Buff details

  • buff initial source:Ciaran
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • celestial_alignment_1:10.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:112071
  • name:Celestial Alignment
  • tooltip:Balance Energy cycle paused. All Lunar and Solar spells benefit from your maximum Eclipse bonus. Damage dealt increased by {$s2=20}%. Your Moonfire and Sunfire spells to also apply the other's damage over time effect.
  • description:You enter Celestial Alignment, a state where your Balance Energy cycle is paused, and all of your Lunar and Solar spells benefit from your maximum Eclipse bonus. Also increases your damage dealt by {$s2=20}%, and causes your Moonfire and Sunfire spells to also apply the other's damage over time effect. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
draenic_intellect_potion 2.0 0.0 186.3sec 0.0sec 15.21% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Ciaran
  • cooldown name:buff_draenic_intellect_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:1000.00

Stack Uptimes

  • draenic_intellect_potion_1:15.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156426
  • name:Draenic Intellect Potion
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
lunar_empowerment 18.2 1.1 16.6sec 16.2sec 65.36% 68.97% 1.1(1.3)

Buff details

  • buff initial source:Ciaran
  • cooldown name:buff_lunar_empowerment
  • max_stacks:2
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • lunar_empowerment_1:25.37%
  • lunar_empowerment_2:39.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:The damage of your next Starfire is increased by $w1%$?$w2>0[, and its cast time is reduced by $w2%][].
  • description:Increases the damage of your next $n Starfires within {$d=30 seconds} by {$s1=30}%.
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
lunar_peak 7.1 0.0 42.5sec 42.5sec 9.77% 11.43% 0.0(0.0)

Buff details

  • buff initial source:Ciaran
  • cooldown name:buff_lunar_peak
  • max_stacks:2
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • lunar_peak_1:9.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:171743
  • name:Lunar Peak
  • tooltip:Increases the damage of your next Moonfire by {$s1=100}%.
  • description:{$@spelldesc8921=A Lunar spell that burns the enemy for {$164812s1=1 + 40.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=20 seconds}.{$?s79577=false}[ Upon reaching 100 Lunar Energy, your next Moonfire within {$171743d=5 seconds} will deal {$171743s1=100}% additional initial damage.][]}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
nightmare_fire 2.8 0.0 125.9sec 125.9sec 18.08% 18.09% 0.0(0.0)

Buff details

  • buff initial source:Ciaran
  • cooldown name:buff_nightmare_fire
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:crit_rating
  • amount:1396.00

Stack Uptimes

  • nightmare_fire_1:18.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162919
  • name:Nightmare Fire
  • tooltip:Critical strike increased by {$s1=1044}.
  • description:Critical strike increased by {$s1=1044} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
solar_empowerment 10.8 0.6 24.2sec 22.8sec 40.38% 44.99% 0.6(1.0)

Buff details

  • buff initial source:Ciaran
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • solar_empowerment_1:11.74%
  • solar_empowerment_2:13.03%
  • solar_empowerment_3:15.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:The damage of your next Wrath is increased by $w1%$?$w2>0[, and its cast time is reduced by $w2%][].
  • description:Increases the damage of your next $n Wraths within {$d=30 seconds} by {$s1=30}%.
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
solar_peak 6.6 0.0 42.7sec 42.7sec 1.29% 5.49% 0.0(0.0)

Buff details

  • buff initial source:Ciaran
  • cooldown name:buff_solar_peak
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • solar_peak_1:1.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:171744
  • name:Solar Peak
  • tooltip:Increases the damage of your next Sunfire by {$s1=100}%.
  • description:{$@spelldesc93402=A Solar spell that burns the enemy for {$164815s1=389} Nature damage and then an additional $164815o2 Nature damage over {$164815d=24 seconds}{$?s33605=false}[to the primary target and all enemies within $164815A2 yards][]. Upon reaching 100 Solar Energy, your next Sunfire within {$171744d=5 seconds} will deal {$171744s1=100}% additional initial damage.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_intellect_flask

Buff details

  • buff initial source:Ciaran
  • cooldown name:buff_greater_draenic_intellect_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:250.00

Stack Uptimes

  • greater_draenic_intellect_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156079
  • name:Greater Draenic Intellect Flask
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
moonkin_form

Buff details

  • buff initial source:Ciaran
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • moonkin_form_1:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Arcane and Nature damage done increased by {$24905s2=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=true}[Astral Form][Moonkin Form], increasing Arcane and Nature damage you deal by {$24905s2=10}% and increasing your armor by $m3%. Grants {$24907s1=550} Mastery to all party and raid members within $24907a1 yards. The act of shapeshifting frees the caster of movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Ciaran
moonfire Mana 8.0 8451.4 1056.0 938.7 90.0
starfire Mana 52.6 50485.5 960.0 960.0 40.3
starsurge Mana 30.7 29475.7 960.0 960.0 40.3
sunfire Mana 8.6 9078.0 1056.0 952.1 77.9
wrath Mana 61.7 69096.1 1120.0 1120.0 17.9
Resource Gains Type Count Total Average Overflow
yseras_gift Health 4.00 0.00 (0.00%) 0.00 38469.81 100.00%
energy_regen Energy 169.02 0.00 (0.00%) 0.00 3535.20 100.00%
external_healing Health 52.22 0.00 (0.00%) 0.00 364212.46 100.00%
mp5_regen Mana 169.02 166384.89 (100.00%) 984.42 539693.04 76.44%
leech Health 763.35 0.00 (0.00%) 0.00 39980.66 100.00%
Resource RPS-Gain RPS-Loss
Mana 552.89 553.56
Combat End Resource Mean Min Max
Mana 159792.23 158880.00 160000.00
Eclipse 7.94 -105.00 105.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 79.5%
treant-Mana Cap 79.5%
treant-Mana Cap 79.5%
treant-Mana Cap 79.5%
treant-Mana Cap 79.5%

Procs

Count Interval
Shooting Stars overflow (buff already up) 0.1 69.0sec
Shooting Stars 19.5 14.6sec
wrong_eclipse_wrath 0.0 113.2sec
wrong_eclipse_starfire 0.0 0.0sec

Statistics & Data Analysis

Fight Length
Sample Data Ciaran Fight Length
Count 25000
Mean 300.94
Minimum 230.43
Maximum 374.11
Spread ( max - min ) 143.68
Range [ ( max - min ) / 2 * 100% ] 23.87%
DPS
Sample Data Ciaran Damage Per Second
Count 25000
Mean 20262.23
Minimum 17957.35
Maximum 23478.27
Spread ( max - min ) 5520.91
Range [ ( max - min ) / 2 * 100% ] 13.62%
Standard Deviation 707.4352
5th Percentile 19143.92
95th Percentile 21477.90
( 95th Percentile - 5th Percentile ) 2333.99
Mean Distribution
Standard Deviation 4.4742
95.00% Confidence Intervall ( 20253.46 - 20271.00 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 46
0.1% Error 4682
0.1 Scale Factor Error with Delta=300 4272
0.05 Scale Factor Error with Delta=300 17089
0.01 Scale Factor Error with Delta=300 427225
Distribution Chart
DPS(e)
Sample Data Ciaran Damage Per Second (Effective)
Count 25000
Mean 20262.23
Minimum 17957.35
Maximum 23478.27
Spread ( max - min ) 5520.91
Range [ ( max - min ) / 2 * 100% ] 13.62%
Damage
Sample Data Ciaran Damage
Count 25000
Mean 6041046.63
Minimum 4367880.52
Maximum 7854447.78
Spread ( max - min ) 3486567.26
Range [ ( max - min ) / 2 * 100% ] 28.86%
DTPS
Sample Data Ciaran Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Ciaran Healing Per Second
Count 25000
Mean 128.04
Minimum 0.00
Maximum 1927.10
Spread ( max - min ) 1927.10
Range [ ( max - min ) / 2 * 100% ] 752.53%
Standard Deviation 475.2706
5th Percentile 0.00
95th Percentile 1881.99
( 95th Percentile - 5th Percentile ) 1881.99
Mean Distribution
Standard Deviation 3.0059
95.00% Confidence Intervall ( 122.15 - 133.93 )
Normalized 95.00% Confidence Intervall ( 95.40% - 104.60% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 529272
0.1% Error 52927283
0.1 Scale Factor Error with Delta=300 1928
0.05 Scale Factor Error with Delta=300 7713
0.01 Scale Factor Error with Delta=300 192825
Distribution Chart
HPS(e)
Sample Data Ciaran Healing Per Second (Effective)
Count 25000
Mean 128.04
Minimum 0.00
Maximum 1927.10
Spread ( max - min ) 1927.10
Range [ ( max - min ) / 2 * 100% ] 752.53%
Heal
Sample Data Ciaran Heal
Count 25000
Mean 38451.19
Minimum 0.00
Maximum 706909.77
Spread ( max - min ) 706909.77
Range [ ( max - min ) / 2 * 100% ] 919.23%
HTPS
Sample Data Ciaran Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Ciaran Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data CiaranTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Ciaran Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_intellect_flask
1 0.00 food,type=sleeper_surprise
2 0.00 mark_of_the_wild,if=!aura.str_agi_int.up
3 0.00 moonkin_form
4 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
5 0.00 potion,name=draenic_intellect
6 0.00 stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 potion,name=draenic_intellect,if=buff.celestial_alignment.up
8 0.00 blood_fury,if=buff.celestial_alignment.up
9 0.00 berserking,if=buff.celestial_alignment.up
A 0.00 arcane_torrent,if=buff.celestial_alignment.up
B 16.78 force_of_nature,if=trinket.stat.intellect.up|charges=3|target.time_to_die<21
C 0.00 call_action_list,name=single_target,if=active_enemies=1
D 0.00 call_action_list,name=aoe,if=active_enemies>1
actions.single_target
# count action,conditions
E 17.13 starsurge,if=buff.lunar_empowerment.down&eclipse_energy>20
F 10.53 starsurge,if=buff.solar_empowerment.down&eclipse_energy<-40
G 3.05 starsurge,if=(charges=2&recharge_time<6)|charges=3
H 2.01 celestial_alignment,if=eclipse_energy>40
I 0.00 incarnation,if=eclipse_energy>0
J 8.60 sunfire,if=remains<7|buff.solar_peak.up
K 0.00 stellar_flare,if=remains<7
L 8.00 moonfire,if=buff.lunar_peak.up&remains<eclipse_change+20|remains<4|(buff.celestial_alignment.up&buff.celestial_alignment.remains<=2&remains<eclipse_change+20)
M 62.07 wrath,if=(eclipse_energy<=0&eclipse_change>cast_time)|(eclipse_energy>0&cast_time>eclipse_change)
N 53.01 starfire,if=(eclipse_energy>=0&eclipse_change>cast_time)|(eclipse_energy<0&cast_time>eclipse_change)

Sample Sequence

0135BGLNHJNENNENNENBNENNNNNMJMFMMBMFJMMMFMNELNBNENNEMMMMMMBJMMMMMNLNENBNNNMMMMMMJBMMFMMNLNNNBNNNEMMFMMJMBFMMMMNLNENH7NBENNNNLNNNBMMMMMFJMMMFMNBNNNLNNNMGBMMMFJMMMFMNNBBBENNLENNMMMMBM

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse
Pre food Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse
Pre moonkin_form Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse
Pre potion Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse draenic_intellect_potion
0:00.000 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse draenic_intellect_potion
0:00.000 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse draenic_intellect_potion
0:01.328 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 21.7/105: 21% eclipse bloodlust, lunar_empowerment(2), draenic_intellect_potion
0:02.351 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 37.9/105: 36% eclipse bloodlust, lunar_empowerment(2), draenic_intellect_potion
0:04.390 celestial_alignment Fluffy_Pillow 160000.0/160000: 100% mana | 66.8/105: 64% eclipse bloodlust, lunar_empowerment, draenic_intellect_potion
0:04.390 sunfire Fluffy_Pillow 160000.0/160000: 100% mana | 66.8/105: 64% eclipse bloodlust, celestial_alignment, lunar_empowerment, draenic_intellect_potion
0:05.411 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 66.8/105: 64% eclipse bloodlust, celestial_alignment, lunar_empowerment, draenic_intellect_potion
0:07.451 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 66.8/105: 64% eclipse bloodlust, celestial_alignment, draenic_intellect_potion
0:08.474 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 66.8/105: 64% eclipse bloodlust, celestial_alignment, lunar_empowerment(2), nightmare_fire, draenic_intellect_potion
0:10.514 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 66.8/105: 64% eclipse bloodlust, celestial_alignment, lunar_empowerment, nightmare_fire, draenic_intellect_potion
0:12.554 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 66.8/105: 64% eclipse bloodlust, celestial_alignment, nightmare_fire, draenic_intellect_potion
0:13.576 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 66.8/105: 64% eclipse bloodlust, celestial_alignment, lunar_empowerment(2), nightmare_fire, draenic_intellect_potion
0:15.615 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 66.8/105: 64% eclipse bloodlust, celestial_alignment, lunar_empowerment, nightmare_fire, draenic_intellect_potion
0:17.654 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 66.8/105: 64% eclipse bloodlust, celestial_alignment, nightmare_fire, draenic_intellect_potion
0:18.676 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 66.8/105: 64% eclipse bloodlust, celestial_alignment, lunar_empowerment(2), nightmare_fire, draenic_intellect_potion
0:20.715 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana | 82.1/105: 78% eclipse bloodlust, lunar_empowerment, nightmare_fire
0:20.715 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 82.1/105: 78% eclipse bloodlust, lunar_empowerment, nightmare_fire
0:22.754 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 98.5/105: 94% eclipse bloodlust, nightmare_fire
0:23.775 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 103.1/105: 98% eclipse bloodlust, lunar_empowerment(2), lunar_peak, nightmare_fire
0:25.816 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 104.1/105: 99% eclipse bloodlust, lunar_empowerment, lunar_peak, nightmare_fire
0:27.858 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 94.6/105: 90% eclipse bloodlust, lunar_peak
0:29.898 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 75.4/105: 72% eclipse bloodlust
0:31.939 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 48.6/105: 46% eclipse bloodlust
0:33.978 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 16.8/105: 16% eclipse bloodlust
0:35.339 sunfire Fluffy_Pillow 160000.0/160000: 100% mana bloodlust
0:36.362 wrath Fluffy_Pillow 160000.0/160000: 100% mana bloodlust
0:37.722 starsurge Fluffy_Pillow 160000.0/160000: 100% mana bloodlust
0:38.745 wrath Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, solar_empowerment(3)
0:40.106 wrath Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, solar_empowerment(2)
0:41.467 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment
0:41.467 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment
0:43.235 starsurge Fluffy_Pillow 160000.0/160000: 100% mana solar_peak
0:44.562 sunfire Fluffy_Pillow 160000.0/160000: 100% mana solar_peak, solar_empowerment(3)
0:45.888 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(3)
0:47.657 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(2)
0:49.424 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment
0:51.193 starsurge Fluffy_Pillow 160000.0/160000: 100% mana
0:52.520 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(3)
0:54.286 starfire Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(2)
0:56.938 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 31.5/105: 30% eclipse solar_empowerment(2)
0:58.266 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 51.5/105: 49% eclipse lunar_empowerment(2), solar_empowerment(2)
0:59.592 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 69.3/105: 66% eclipse lunar_empowerment(2), solar_empowerment(2)
1:02.243 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana | 95.3/105: 91% eclipse lunar_empowerment, solar_empowerment(2)
1:02.243 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 95.3/105: 91% eclipse lunar_empowerment, solar_empowerment(2)
1:04.896 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 105.0/105: 100% eclipse lunar_peak, solar_empowerment(2)
1:06.225 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 103.1/105: 98% eclipse lunar_empowerment(2), lunar_peak, solar_empowerment(2)
1:08.876 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 86.1/105: 82% eclipse lunar_empowerment, solar_empowerment(2)
1:11.527 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 54.5/105: 52% eclipse solar_empowerment(2)
1:12.855 Waiting 0.400 sec 160000.0/160000: 100% mana | 34.7/105: 33% eclipse lunar_empowerment(2), solar_empowerment(2)
1:13.255 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 28.4/105: 27% eclipse lunar_empowerment(2), solar_empowerment(2)
1:15.024 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment
1:16.794 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
1:18.563 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
1:20.332 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
1:22.101 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
1:23.870 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_peak
1:23.870 sunfire Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_peak
1:25.197 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
1:26.965 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
1:28.734 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
1:30.503 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
1:32.272 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
1:34.040 starfire Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
1:36.691 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 27.6/105: 26% eclipse lunar_empowerment
1:38.018 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 47.9/105: 46% eclipse lunar_empowerment
1:40.670 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 81.6/105: 78% eclipse
1:41.997 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 93.5/105: 89% eclipse lunar_empowerment(2)
1:44.648 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana | 104.8/105: 100% eclipse lunar_empowerment, lunar_peak
1:44.648 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 104.8/105: 100% eclipse lunar_empowerment, lunar_peak
1:47.300 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 98.2/105: 94% eclipse lunar_peak
1:49.952 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 74.8/105: 71% eclipse
1:52.604 Waiting 0.700 sec 160000.0/160000: 100% mana | 38.6/105: 37% eclipse
1:53.304 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 27.6/105: 26% eclipse
1:55.073 wrath Fluffy_Pillow 160000.0/160000: 100% mana
1:56.840 wrath Fluffy_Pillow 160000.0/160000: 100% mana
1:58.609 wrath Fluffy_Pillow 160000.0/160000: 100% mana
2:00.379 wrath Fluffy_Pillow 160000.0/160000: 100% mana
2:02.148 wrath Fluffy_Pillow 160000.0/160000: 100% mana
2:03.916 sunfire Fluffy_Pillow 160000.0/160000: 100% mana solar_peak, nightmare_fire
2:05.244 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana nightmare_fire
2:05.244 wrath Fluffy_Pillow 160000.0/160000: 100% mana nightmare_fire
2:07.012 wrath Fluffy_Pillow 160000.0/160000: 100% mana nightmare_fire
2:08.780 starsurge Fluffy_Pillow 160000.0/160000: 100% mana nightmare_fire
2:10.107 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(3), nightmare_fire
2:11.877 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(2), nightmare_fire
2:13.645 starfire Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment, nightmare_fire
2:16.297 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 21.2/105: 20% eclipse solar_empowerment, nightmare_fire
2:17.624 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 42.1/105: 40% eclipse solar_empowerment, nightmare_fire
2:20.275 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 77.4/105: 74% eclipse solar_empowerment, nightmare_fire
2:22.926 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 99.5/105: 95% eclipse solar_empowerment, nightmare_fire
2:25.575 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana | 104.6/105: 100% eclipse lunar_peak, solar_empowerment
2:25.575 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 104.6/105: 100% eclipse lunar_peak, solar_empowerment
2:28.226 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 91.8/105: 87% eclipse lunar_peak, solar_empowerment
2:30.878 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 63.3/105: 60% eclipse solar_empowerment
2:33.531 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 24.0/105: 23% eclipse solar_empowerment
2:34.859 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 2.3/105: 2% eclipse lunar_empowerment(2), solar_empowerment
2:36.628 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
2:38.395 starsurge Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
2:39.724 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment(3)
2:41.492 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment(2)
2:43.261 sunfire Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_peak, solar_empowerment
2:44.589 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment
2:46.358 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
2:46.358 starsurge Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
2:47.687 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment(3)
2:49.457 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment(2)
2:51.224 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment
2:52.990 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
2:54.756 starfire Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
2:57.407 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 38.8/105: 37% eclipse lunar_empowerment
2:58.735 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 58.1/105: 55% eclipse lunar_empowerment
3:01.386 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 88.5/105: 84% eclipse
3:02.713 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 98.3/105: 94% eclipse lunar_empowerment(2)
3:05.364 celestial_alignment Fluffy_Pillow 160000.0/160000: 100% mana | 104.8/105: 100% eclipse lunar_empowerment, lunar_peak
3:05.364 potion Fluffy_Pillow 160000.0/160000: 100% mana | 104.8/105: 100% eclipse celestial_alignment, lunar_empowerment, lunar_peak
3:05.364 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 104.8/105: 100% eclipse celestial_alignment, lunar_empowerment, lunar_peak, draenic_intellect_potion
3:08.015 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana | 104.8/105: 100% eclipse celestial_alignment, lunar_peak, draenic_intellect_potion
3:08.015 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 104.8/105: 100% eclipse celestial_alignment, lunar_peak, draenic_intellect_potion
3:09.341 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 104.8/105: 100% eclipse celestial_alignment, lunar_empowerment(2), draenic_intellect_potion
3:11.992 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 104.8/105: 100% eclipse celestial_alignment, lunar_empowerment, draenic_intellect_potion
3:14.643 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 104.8/105: 100% eclipse celestial_alignment, draenic_intellect_potion
3:17.293 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 104.8/105: 100% eclipse celestial_alignment, draenic_intellect_potion
3:19.946 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 104.8/105: 100% eclipse celestial_alignment, draenic_intellect_potion
3:21.273 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 102.9/105: 98% eclipse draenic_intellect_potion
3:23.923 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 85.7/105: 82% eclipse draenic_intellect_potion
3:26.574 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 53.8/105: 51% eclipse draenic_intellect_potion
3:29.226 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana | 12.7/105: 12% eclipse draenic_intellect_potion
3:29.226 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 12.7/105: 12% eclipse draenic_intellect_potion
3:30.994 wrath Fluffy_Pillow 160000.0/160000: 100% mana
3:32.762 wrath Fluffy_Pillow 160000.0/160000: 100% mana
3:34.531 wrath Fluffy_Pillow 160000.0/160000: 100% mana
3:36.299 wrath Fluffy_Pillow 160000.0/160000: 100% mana
3:38.069 starsurge Fluffy_Pillow 160000.0/160000: 100% mana solar_peak
3:39.396 sunfire Fluffy_Pillow 160000.0/160000: 100% mana solar_peak, solar_empowerment(3)
3:40.725 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(3)
3:42.494 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(2)
3:44.263 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment
3:46.032 starsurge Fluffy_Pillow 160000.0/160000: 100% mana
3:47.359 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(3)
3:49.127 starfire Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(2)
3:51.778 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana | 28.9/105: 28% eclipse solar_empowerment(2)
3:51.778 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 28.9/105: 28% eclipse solar_empowerment(2)
3:54.429 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 67.3/105: 64% eclipse solar_empowerment(2)
3:57.082 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 94.2/105: 90% eclipse solar_empowerment(2)
3:59.735 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 104.9/105: 100% eclipse lunar_peak, solar_empowerment(2)
4:01.062 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 103.5/105: 99% eclipse solar_empowerment(2)
4:03.713 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 87.6/105: 83% eclipse solar_empowerment(2)
4:06.363 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 56.8/105: 54% eclipse solar_empowerment(2)
4:09.016 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 16.2/105: 15% eclipse solar_empowerment(2)
4:10.786 starsurge Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment
4:12.113 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(3)
4:12.113 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(3)
4:13.883 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(2)
4:15.651 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment
4:17.420 starsurge Fluffy_Pillow 160000.0/160000: 100% mana
4:18.746 sunfire Fluffy_Pillow 160000.0/160000: 100% mana solar_peak, solar_empowerment(3)
4:20.074 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(3), nightmare_fire
4:21.843 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(2), nightmare_fire
4:23.610 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment, nightmare_fire
4:25.378 starsurge Fluffy_Pillow 160000.0/160000: 100% mana nightmare_fire
4:26.705 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(3), nightmare_fire
4:28.474 starfire Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(2), nightmare_fire
4:31.125 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 18.5/105: 18% eclipse solar_empowerment(2), nightmare_fire
4:33.775 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana | 58.7/105: 56% eclipse solar_empowerment(2), nightmare_fire
4:33.775 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana | 58.7/105: 56% eclipse solar_empowerment(2), nightmare_fire
4:33.775 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana | 58.7/105: 56% eclipse solar_empowerment(2), nightmare_fire
4:33.775 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 58.7/105: 56% eclipse solar_empowerment(2), nightmare_fire
4:35.102 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 75.4/105: 72% eclipse lunar_empowerment(2), solar_empowerment(2), nightmare_fire
4:37.755 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 98.5/105: 94% eclipse lunar_empowerment, solar_empowerment(2), nightmare_fire
4:40.408 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 104.8/105: 100% eclipse lunar_peak, solar_empowerment(2)
4:41.738 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 101.1/105: 96% eclipse solar_empowerment(2)
4:43.066 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 93.1/105: 89% eclipse lunar_empowerment(2), solar_empowerment(2)
4:45.717 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 65.4/105: 62% eclipse lunar_empowerment, solar_empowerment(2)
4:48.368 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 26.6/105: 25% eclipse solar_empowerment(2)
4:50.137 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment
4:51.906 wrath Fluffy_Pillow 160000.0/160000: 100% mana
4:53.675 wrath Fluffy_Pillow 160000.0/160000: 100% mana
4:55.444 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana
4:55.444 wrath Fluffy_Pillow 160000.0/160000: 100% mana

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 653 622 622
Agility 1352 1288 1288
Stamina 4073 3703 3703
Intellect 3876 3430 3319 (2225)
Spirit 782 782 782
Health 244380 222180 0
Mana 160000 160000 0
Eclipse 105 105 0
Spell Power 5317 4388 958
Crit 13.48% 8.48% 383
Haste 13.34% 7.94% 687
Multistrike 11.47% 6.47% 427
Damage / Heal Versatility 5.76% 2.76% 359
ManaReg per Second 2325 640 0
Mastery 44.25% 32.61% 1033
Armor 2616 872 872

Talents

Level
15 Feline Swiftness Displacer Beast Wild Charge
30 Ysera's Gift Renewal Cenarion Ward
45 Faerie Swarm (Balance Druid) Mass Entanglement Typhoon
60 Soul of the Forest Incarnation: Chosen of Elune Force of Nature
75 Incapacitating Roar Ursol's Vortex Mighty Bash
90 Heart of the Wild Dream of Cenarius Nature's Vigil
100 Euphoria Stellar Flare Balance of Power

Profile

druid="Ciaran"
origin="http://eu.battle.net/wow/en/character/forscherliga/Ciaran/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/225/94028513-avatar.jpg"
level=100
race=night_elf
role=spell
position=back
professions=leatherworking=35/skinning=289
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Ua!0022022
glyphs=guided_stars/rebirth/stars/chameleon/stag
spec=balance

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_intellect_flask
actions.precombat+=/food,type=sleeper_surprise
actions.precombat+=/mark_of_the_wild,if=!aura.str_agi_int.up
actions.precombat+=/moonkin_form
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=draenic_intellect
actions.precombat+=/stellar_flare

# Executed every time the actor is available.

actions=potion,name=draenic_intellect,if=buff.celestial_alignment.up
actions+=/blood_fury,if=buff.celestial_alignment.up
actions+=/berserking,if=buff.celestial_alignment.up
actions+=/arcane_torrent,if=buff.celestial_alignment.up
actions+=/force_of_nature,if=trinket.stat.intellect.up|charges=3|target.time_to_die<21
actions+=/call_action_list,name=single_target,if=active_enemies=1
actions+=/call_action_list,name=aoe,if=active_enemies>1

actions.single_target=starsurge,if=buff.lunar_empowerment.down&eclipse_energy>20
actions.single_target+=/starsurge,if=buff.solar_empowerment.down&eclipse_energy<-40
actions.single_target+=/starsurge,if=(charges=2&recharge_time<6)|charges=3
actions.single_target+=/celestial_alignment,if=eclipse_energy>40
actions.single_target+=/incarnation,if=eclipse_energy>0
actions.single_target+=/sunfire,if=remains<7|buff.solar_peak.up
actions.single_target+=/stellar_flare,if=remains<7
actions.single_target+=/moonfire,if=buff.lunar_peak.up&remains<eclipse_change+20|remains<4|(buff.celestial_alignment.up&buff.celestial_alignment.remains<=2&remains<eclipse_change+20)
actions.single_target+=/wrath,if=(eclipse_energy<=0&eclipse_change>cast_time)|(eclipse_energy>0&cast_time>eclipse_change)
actions.single_target+=/starfire,if=(eclipse_energy>=0&eclipse_change>cast_time)|(eclipse_energy<0&cast_time>eclipse_change)

actions.aoe=celestial_alignment,if=lunar_max<8|target.time_to_die<20
actions.aoe+=/incarnation,if=buff.celestial_alignment.up
actions.aoe+=/sunfire,cycle_targets=1,if=remains<8
actions.aoe+=/starfall,if=!buff.starfall.up&active_enemies>2
actions.aoe+=/starsurge,if=(charges=2&recharge_time<6)|charges=3
actions.aoe+=/moonfire,cycle_targets=1,if=remains<12
actions.aoe+=/stellar_flare,cycle_targets=1,if=remains<7
actions.aoe+=/starsurge,if=buff.lunar_empowerment.down&eclipse_energy>20&active_enemies=2
actions.aoe+=/starsurge,if=buff.solar_empowerment.down&eclipse_energy<-40&active_enemies=2
actions.aoe+=/wrath,if=(eclipse_energy<=0&eclipse_change>cast_time)|(eclipse_energy>0&cast_time>eclipse_change)
actions.aoe+=/starfire,if=(eclipse_energy>=0&eclipse_change>cast_time)|(eclipse_energy<0&cast_time>eclipse_change)

head=alloyinlaid_cap,id=116212
neck=cratermaker_choker,id=116285,bonus_id=560
shoulders=supple_shoulderguards,id=116176,bonus_id=48/525/536
back=brilliant_hexweave_cloak,id=114819,bonus_id=170/525/537,enchant=gift_of_mastery
chest=witherleaf_chestguard,id=120088
wrists=bracers_of_determined_resolve,id=114494,bonus_id=114/560/563,gems=50mastery
hands=exceptional_crystalhide_grips,id=115388
waist=cord_of_ruination,id=115430
legs=blackwater_leggings,id=109823,bonus_id=524
feet=boots_of_determined_resolve,id=114502,bonus_id=41/102/560
finger1=darkflame_loop,id=109766,bonus_id=524,enchant=30mastery
finger2=timeless_solium_band_of_the_archmage,id=118296,enchant=50mastery
trinket1=emblem_of_gushing_wounds,id=116290
trinket2=sandmans_pouch,id=112320,bonus_id=525/529
main_hand=spire_of_the_furious_construct,id=110031,bonus_id=41/524,enchant=mark_of_the_shattered_hand

# Gear Summary
# gear_stamina=2813
# gear_intellect=2225
# gear_spell_power=958
# gear_crit_rating=383
# gear_haste_rating=687
# gear_mastery_rating=984
# gear_armor=872
# gear_multistrike_rating=427
# gear_versatility_rating=359
# gear_leech_rating=182

Kernoris

Kernoris : 21375 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR   HPS HPS(e) HPS Error HPS Range HPR
21374.5 21374.5 9.2 / 0.043% 2927.0 / 13.7% 1339.7       124.2 124.2 5.68 / 4.58% 1829 / 1472.5% 7.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
15.9 15.9 Energy 38.91% 41.1 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Kernoris/advanced
Talents
  • 15: Wild Charge
  • 30: Ysera's Gift
  • 45: Typhoon
  • 60: Soul of the Forest (Feral Druid)
  • 75: Mighty Bash
  • 90: Dream of Cenarius (Feral Druid)
  • 100: Bloodtalons (Feral Druid)
  • Talent Calculator
Glyphs
  • Glyph of Savage Roar
  • Glyph of Cat Form
  • Glyph of Ferocious Bite
  • Glyph of Grace
  • Glyph of Travel
  • Glyph of Aquatic Form
Professions
  • alchemy: 700
  • herbalism: 700

Charts

http://0.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Kernoris+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x210&chd=t:136212|76178|46478|28674|13011|5382&chds=0,272424&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++136212++rip,C79C6E,0,0,15|t++76178++ferocious_bite,C79C6E,1,0,15|t++46478++rake,C79C6E,2,0,15|t++28674++thrash_cat,C79C6E,3,0,15|t++13011++shred,C79C6E,4,0,15|t++5382++cat_melee,C79C6E,5,0,15& http://1.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Kernoris+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:25,20,20,17,17,1&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=cat_melee|shred|rip|rake|ferocious_bite|thrash_cat&
http://3.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Kernoris+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:eimoquy258777555222xurpppmljiijijiijjjjjjjjiihgfedcccdddeeeffffffgggggfffedcbbaaaaabbcddddeeedeeeeeeeeedccbaaaaabbbbccccdccddddedeeeeeeddddddddccdddddddddddddddddddddccccccbbccddefghijklnnopqrrsrrrqppnmlkkjjiiihiihhhhhhhiiiihhhggffeeeefffgghhhhiiiiijjjjjjjjjiihhhhhhhiiijkkklkkllllllllllkkjiiihhhhhiijjkkkkllmmmmmmmmmmllkkkjjjijjkkkllllmmmmmlllllkkjihhgffeddddddcbaYXWUTRQON&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.574874,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=21375|max=37181&chxp=1,1,57,100 http://6.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Kernoris+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:2,1,3,5,8,20,43,71,100,173,236,352,488,582,862,993,1103,1222,1442,1557,1600,1656,1610,1568,1411,1244,1133,1022,869,727,656,499,421,334,258,193,152,127,81,50,36,22,17,26,6,7,5,2,3,2&chds=0,1656&chbh=5&chxt=x&chxl=0:|min=18724|avg=21375|max=24664&chxp=0,1,45,100& http://2.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Kernoris+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:32.9,9.4,7.8,4.7,3.1,2.6,0.8,38.9&chds=0,100&chdls=ffffff&chco=C79C6E,ABD473,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ffffff&chl=shred 99.1s|healing_touch 28.2s|rake 23.4s|ferocious_bite 14.0s|rip 9.4s|savage_roar 7.7s|thrash_cat 2.5s|waiting 117.1s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Kernoris 21375
cat_melee 5384 25.2% 355.3 0.85sec 4555 5382 Direct 355.3 3349 6697 4298 28.4% 70.8 1004 2009 28.4%  

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 355.29 355.29 0.00 0.00 0.8463 0.0000 1618336.47 2487127.63 34.93 5382.22 5382.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 20.07 28.36% 2008.69 1333 2605 2009.87 1813 2286 40318 61962 34.93
multistrike 50.69 71.64% 1004.46 666 1303 1005.03 958 1082 50919 78254 34.93
hit 254.56 71.65% 3348.63 2221 4342 3350.53 3292 3423 852415 1310028 34.93
crit 100.74 28.35% 6697.35 4442 8684 6701.18 6421 7009 674684 1036883 34.93
 
DPS Timeline Chart
 

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
ferocious_bite 3570 16.6% 14.0 21.77sec 76517 76178 Direct 14.0 46131 92211 72223 56.6% 2.8 13867 27686 56.7%  

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.95 13.95 0.00 0.00 1.0045 0.0000 1067555.52 1640664.27 34.93 76177.79 76177.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.57 56.74% 27686.30 2044 37210 22162.95 0 37210 43368 66649 27.95
multistrike 1.19 43.26% 13867.24 1022 18605 9750.99 0 18605 16559 25449 24.54
hit 6.05 43.38% 46131.05 3329 62017 46184.39 0 62017 279199 429085 34.91
crit 7.90 56.62% 92210.95 6655 124034 92389.56 0 124034 728429 1119481 34.93
 
DPS Timeline Chart
 

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rip.ticking&dot.rip.remains<3&target.health.pct<25
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:
  • description:Finishing move that causes damage per combo point{$?s67598=true}[, consumes up to 25 additional Energy to increase damage by up to 100%, and heals you for $67598m1% of your total maximum health for each $67598m2 Energy used.][ and consumes up to 25 additional Energy to increase damage by up to 100%.]{$?s1079=true}[ When used on targets below 25% health, Ferocious Bite will also refresh the duration of your Rip on your target.][] Critical strike chance doubled against bleeding targets. 1 point : ${$m1*1/5} damage 2 points: ${$m1*2/5} damage 3 points: ${$m1*3/5} damage 4 points: ${$m1*4/5} damage 5 points: ${$m1*5/5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.400000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
rake 3612 16.9% 23.2 13.04sec 46685 46478 Direct 23.2 6418 12856 8244 28.4% 4.6 1925 3847 28.2%  
Periodic 99.0 6544 13089 8399 28.3% 19.7 2009 4015 28.4% 98.7%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.25 23.25 98.99 98.99 1.0045 3.0000 1085301.73 1085301.73 0.00 3388.01 46477.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.31 28.16% 3846.69 2416 8793 2797.09 0 8793 5023 5023 0.00
multistrike 3.33 71.84% 1924.89 949 4396 1859.70 0 4396 6413 6413 0.00
hit 16.65 71.63% 6417.56 3165 14654 6431.64 5268 7725 106870 106870 0.00
crit 6.59 28.37% 12855.68 6329 29309 12873.00 0 29309 84779 84779 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 5.6 28.37% 4014.63 2658 8793 4002.57 0 8793 22445 22445 0.00
multistrike 14.1 71.63% 2009.15 1329 4396 2012.40 1529 3593 28359 28359 0.00
hit 70.9 71.66% 6543.58 2 14654 6553.80 5816 7248 464202 464202 0.00
crit 28.1 28.34% 13088.96 4 29309 13109.97 10188 16673 367211 367211 0.00
 
DPS Timeline Chart
 

Action details: rake

Static Values
  • id:1822
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.prowl.up
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:
  • description:Rake the target for {$s1=1} Bleed damage and an additional $155722o1 Bleed damage over {$155722d=15 seconds}. Awards {$s2=1} combo $lpoint:points;. If used while stealthed, the target will be stunned for {$163505d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.400000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.400000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
rip 4273 20.1% 9.4 25.03sec 136815 136212 Periodic 142.9 6622 13243 8499 28.4% 28.4 1987 3973 28.3% 95.0%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.41 9.41 142.89 142.89 1.0045 2.0000 1286933.24 1286933.24 0.00 4359.10 136212.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.41 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 8.0 28.32% 3973.06 2856 5433 3969.69 0 5433 31983 31983 0.00
multistrike 20.4 71.68% 1986.68 1428 2716 1985.88 1636 2330 40468 40468 0.00
hit 102.4 71.65% 6622.14 1086 9054 6619.03 5648 7220 677973 677973 0.00
crit 40.5 28.35% 13243.42 8091 18108 13237.19 10981 14868 536509 536509 0.00
 
DPS Timeline Chart
 

Action details: rip

Static Values
  • id:1079
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<3&target.time_to_die-remains>18
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 seconds.
  • description:Finishing move that causes Bleed damage over {$d=24 seconds}. Damage increases per combo point: 1 point : ${$floor(1*$<rip>)*8} damage 2 points: ${$floor(2*$<rip>)*8} damage 3 points: ${$floor(3*$<rip>)*8} damage 4 points: ${$floor(4*$<rip>)*8} damage 5 points: ${$floor(5*$<rip>)*8} damage
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.086000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
shred 4300 20.1% 98.7 3.05sec 13069 13011 Direct 98.7 9609 19221 12334 28.3% 19.6 2882 5768 28.4%  

Stats details: shred

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.66 98.66 0.00 0.00 1.0045 0.0000 1289384.78 1981580.81 34.93 13010.81 13010.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 5.57 28.38% 5768.04 3582 9104 5747.24 0 9104 32106 49341 34.78
multistrike 14.04 71.62% 2882.06 1791 4552 2884.24 2508 3670 40476 62205 34.93
hit 70.69 71.65% 9608.75 5971 15173 9617.56 9176 10244 679248 1043897 34.93
crit 27.97 28.35% 19220.68 11941 30347 19233.05 17463 21614 537555 826138 34.93
 
DPS Timeline Chart
 

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<3
Spelldata
  • id:5221
  • name:Shred
  • school:physical
  • tooltip:
  • description:Shred the target, causing $sw1 Physical damage to the target{$?s48484=false}[ and reducing the target's movement speed by {$58180s1=50}% for {$58180d=12 seconds}][]. Awards {$s2=1} combo $lpoint:points;. Being stealthed increases damage by $5215m4% and doubles critical strike chance. Damage increased by {$106785s2=20}% against bleeding targets.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.00
 
thrash_cat 234 1.1% 2.4 62.01sec 28798 28674 Direct 2.4 4683 9370 6001 28.1% 0.5 1403 2810 28.6%  
Periodic 12.1 3347 6694 4298 28.4% 2.4 1004 2010 28.0% 12.0%

Stats details: thrash_cat

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.45 2.45 12.07 12.07 1.0045 3.0000 70538.59 70538.59 0.00 1824.45 28674.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.14 28.60% 2810.40 2094 3982 365.91 0 3982 393 393 0.00
multistrike 0.35 71.40% 1403.45 1047 1991 405.66 0 1991 490 490 0.00
hit 1.76 71.89% 4682.90 3490 6636 3952.82 0 6636 8246 8246 0.00
crit 0.69 28.11% 9370.24 6979 13273 4738.02 0 13273 6452 6452 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.7 28.03% 2010.16 1496 2845 915.99 0 2845 1356 1356 0.00
multistrike 1.7 71.97% 1003.94 748 1422 731.83 0 1422 1739 1739 0.00
hit 8.6 71.60% 3347.18 2493 4741 3104.65 0 4741 28921 28921 0.00
crit 3.4 28.40% 6693.53 4987 9483 5877.47 0 9483 22942 22942 0.00
 
DPS Timeline Chart
 

Action details: thrash_cat

Static Values
  • id:106830
  • school:physical
  • resource:energy
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:50.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.omen_of_clarity.react&remains<4.5&active_enemies>1
Spelldata
  • id:106830
  • name:Thrash
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2 sec.
  • description:Strikes all enemy targets within $A2 yards, dealing $m1 bleed damage and an additional $o2 damage over {$d=15 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.315000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.225000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Healing and Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Kernoris 124
yseras_gift 124 100.0% 0.0 0.00sec 0 0 Periodic 47.9 780 0 780 0.0% 0.0 0 0 0.0% 79.6%

Stats details: yseras_gift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 0.00 0.80 47.92 47.92 0.0000 5.0000 37345.37 457175.58 91.83 155.87 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.55 68.78% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.25 31.22% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.9 100.00% 779.65 0 9386 626.37 0 9260 37345 457176 73.67
 
HPS Timeline Chart
 

Action details: yseras_gift

Static Values
  • id:145108
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kernoris
  • harmful:false
  • if_expr:
Spelldata
  • id:145108
  • name:Ysera's Gift
  • school:nature
  • tooltip:
  • description:Heals you for {$s1=4}% of your maximum health every $t sec. If you are at full health, a random nearby injured ally will be healed instead.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:720.00
  • base_tick_time:5.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Kernoris
berserk 2.0 183.31sec

Stats details: berserk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.01 2.01 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.44 71.57% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.57 28.43% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: berserk

Static Values
  • id:106952
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.tigers_fury.up
Spelldata
  • id:106952
  • name:Berserk
  • school:physical
  • tooltip:
  • description:When used in Bear Form, removes the cooldown from Mangle and causes it to hit up to {$50334s1=3} targets and lasts {$50334d=10 seconds}. When used in Cat Form, reduces the cost of all Cat Form abilities by {$106951s1=50}% and lasts {$106951d=15 seconds}.
 
cat_form 1.0 0.00sec

Stats details: cat_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.72 71.76% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.28 28.24% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: cat_form

Static Values
  • id:768
  • school:physical
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:2368.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:768
  • name:Cat Form
  • school:physical
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}%.$?$w2=100, and reduces falling damage.[ Additionally, all healing done to you is increased by {$47180s1=20}%][]
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}% and allowing the use of Cat Form abilities. Also protects the caster from Polymorph effects and reduces damage taken from falling.{$?s47180=true}[ Additionally, all healing done to you is increased by {$47180s1=20}%.][] The act of shapeshifting frees the caster of movement impairing effects.
 
draenic_agility_potion 2.0 0.00sec

Stats details: draenic_agility_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156423
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156423
  • name:Draenic Agility Potion
  • school:physical
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
 
healing_touch 29.0 10.57sec

Stats details: healing_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 29.03 29.03 0.00 0.00 0.9699 0.0000 0.00 970657.94 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.81 31.32% 0.00 0 0 0.00 0 0 0 26289 84.02
multistrike 3.98 68.68% 0.00 0 0 0.00 0 0 0 28826 98.02
hit 19.94 68.68% 0.00 0 0 0.00 0 0 0 478875 100.00
crit 9.09 31.32% 0.00 0 0 0.00 0 0 0 436668 100.00
 
HPS Timeline Chart
 

Action details: healing_touch

Static Values
  • id:5185
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3312.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Kernoris
  • harmful:false
  • if_expr:talent.bloodtalons.enabled
Spelldata
  • id:5185
  • name:Healing Touch
  • school:nature
  • tooltip:
  • description:Heals a friendly target for {$s1=0 to 2}{$?s54825=false}[ and reduces your remaining cooldown on Nature's Swiftness by $54825m1 sec][].{$?s24858=false}[ Healing increased by 50% when cast on self.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.600000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
leader_of_the_pack 39.4 7.70sec

Stats details: leader_of_the_pack

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 39.41 39.41 0.00 0.00 0.0000 0.0000 0.00 332966.43 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.41 100.00% 0.00 0 0 0.00 0 0 0 332966 100.00
 
HPS Timeline Chart
 

Action details: leader_of_the_pack

Static Values
  • id:68285
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kernoris
  • harmful:false
  • if_expr:
Spelldata
  • id:68285
  • name:Leader of the Pack
  • school:physical
  • tooltip:
  • description:{$@spelldesc17007=While in Bear Form or Cat Form, increases critical strike chance of all party and raid members within $24932a1 yards by {$24932s1=5}%. Also causes your melee critical strikes to heal you for {$68285s1=3}% of your health. This effect cannot occur more than once every 6 sec.}
 
savage_roar 7.7 37.59sec

Stats details: savage_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.66 7.66 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 7.66 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.savage_roar.remains<3
Spelldata
  • id:52610
  • name:Savage Roar
  • school:physical
  • tooltip:Physical damage done increased by $w2%.
  • description:Finishing move that increases physical damage done by {$62071s1=40}% while in Cat Form. Lasts longer per combo point: 1 point : ${18+$<bonus>} seconds 2 points: ${24+$<bonus>} seconds 3 points: ${30+$<bonus>} seconds 4 points: ${36+$<bonus>} seconds 5 points: ${42+$<bonus>} seconds
 
skull_bash 8.4 37.56sec

Stats details: skull_bash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.41 8.41 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.41 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: skull_bash

Static Values
  • id:106839
  • school:physical
  • resource:none
  • range:13.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:106839
  • name:Skull Bash
  • school:physical
  • tooltip:
  • description:You charge and skull bash the target, interrupting spellcasting and preventing any spell in that school from being cast for {$93985d=4 seconds}.
 
tigers_fury 10.2 30.54sec

Stats details: tigers_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.23 10.23 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.33 71.69% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.90 28.31% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!buff.omen_of_clarity.react&energy.max-energy>=60)|energy.max-energy>=80
Spelldata
  • id:5217
  • name:Tiger's Fury
  • school:physical
  • tooltip:Increases physical damage done by {$s1=15}%.
  • description:Increases physical damage done by {$s1=15}% for {$d=8 seconds} and instantly restores {$s2=60} Energy.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
berserk 2.0 0.0 183.3sec 183.3sec 10.15% 17.21% 0.0(0.0)

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_berserk
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • berserk_1:10.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:106952
  • name:Berserk
  • tooltip:
  • description:When used in Bear Form, removes the cooldown from Mangle and causes it to hit up to {$50334s1=3} targets and lasts {$50334d=10 seconds}. When used in Cat Form, reduces the cost of all Cat Form abilities by {$106951s1=50}% and lasts {$106951d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 42.87% 0.0(0.0)

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
bloodtalons 29.0 0.0 10.5sec 10.6sec 37.80% 38.38% 0.0(0.0)

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_bloodtalons
  • max_stacks:2
  • duration:30.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodtalons_1:22.56%
  • bloodtalons_2:15.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145152
  • name:Bloodtalons
  • tooltip:Your next two melee abilities deal {$s1=30}% additional damage.
  • description:Casting Healing Touch causes your next two melee abilities to deal {$s1=30}% additional damage.
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
draenic_agility_potion 2.0 0.0 258.9sec 0.0sec 15.21% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_draenic_agility_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:1000.00

Stack Uptimes

  • draenic_agility_potion_1:15.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156423
  • name:Draenic Agility Potion
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
omen_of_clarity (omen_of_clarity) 20.3 0.4 14.2sec 14.0sec 4.03% 13.63% 0.4(0.4)

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_omen_of_clarity
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • omen_of_clarity_1:4.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:135700
  • name:Clearcasting
  • tooltip:Your next Cat Form ability has {$s1=100}% reduced Energy cost.
  • description:{$@spelldesc16864=Your autoattacks have a chance to reduce the Energy cost of your next Cat Form ability by {$16870s1=100}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
predatory_swiftness 28.7 0.8 10.5sec 10.2sec 61.68% 100.00% 0.8(0.8)

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • predatory_swiftness_1:61.68%

Trigger Attempt Success

  • trigger_pct:95.24%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Entangling Roots, Healing Touch, or Rebirth will be instant, free, and castable in all forms, and heal for {$s4=20}% more.
  • description:{$@spelldesc16974=Your finishing moves have a $b3% chance per combo point to make your next Healing Touch, Entangling Roots, or Rebirth instant, free, and castable in all forms, and to increase the healing done by Healing Touch by {$69369s4=20}%.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
prowl 1.0 0.0 0.0sec 0.0sec 0.00% 0.13% 0.0(0.0)

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_prowl
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5215
  • name:Prowl
  • tooltip:Stealthed.$?$w2>=0[][ Movement speed slowed by $w2%.]
  • description:Activates Cat Form and places the Druid into stealth{$?s157274=false}[][, but reduces movement speed by {$s2=30}%]. Lasts until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
tigers_fury 10.2 0.0 30.5sec 30.5sec 26.86% 29.32% 0.0(0.0)

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:26.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Increases physical damage done by {$s1=15}%.
  • description:Increases physical damage done by {$s1=15}% for {$d=8 seconds} and instantly restores {$s2=60} Energy.
  • max_stacks:0
  • duration:8.00
  • cooldown:30.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
cat_form

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_cat_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • cat_form_1:100.00%

Spelldata details

  • id:768
  • name:Cat Form
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}%.$?$w2=100, and reduces falling damage.[ Additionally, all healing done to you is increased by {$47180s1=20}%][]
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}% and allowing the use of Cat Form abilities. Also protects the caster from Polymorph effects and reduces damage taken from falling.{$?s47180=true}[ Additionally, all healing done to you is increased by {$47180s1=20}%.][] The act of shapeshifting frees the caster of movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_agility_flask

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_greater_draenic_agility_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:250.00

Stack Uptimes

  • greater_draenic_agility_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156064
  • name:Greater Draenic Agility Flask
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
savage_roar

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_savage_roar
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40

Stack Uptimes

  • savage_roar_1:99.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:52610
  • name:Savage Roar
  • tooltip:Physical damage done increased by $w2%.
  • description:Finishing move that increases physical damage done by {$62071s1=40}% while in Cat Form. Lasts longer per combo point: 1 point : ${18+$<bonus>} seconds 2 points: ${24+$<bonus>} seconds 3 points: ${30+$<bonus>} seconds 4 points: ${36+$<bonus>} seconds 5 points: ${42+$<bonus>} seconds
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Snapshotting Details

Ability Tiger's Fury Bloodtalons
Name Execute % Benefit % Execute % Benefit %
ferocious_bite35.96 %35.96 % 85.92 %85.92 %
rake37.68 %48.12 % 81.66 %92.44 %
rip38.52 %39.82 % 85.02 %89.44 %
shred33.68 %33.68 % 16.53 %16.53 %
thrash_cat (_cat)23.76 %23.58 % 94.43 %94.58 %
Improved Rake
Execute %4.30 %
Benefit %4.49 %
Wasted Buffs0.00

Resources

Resource Usage Type Count Total Average RPE APR
Kernoris
ferocious_bite Energy 27.9 571.0 20.5 40.9 1869.6
rake Energy 23.2 685.1 29.5 29.5 1584.1
rip Energy 9.4 233.2 24.8 24.8 5518.8
savage_roar Energy 7.7 186.2 24.3 24.3 0.0
shred Energy 98.7 3115.2 31.6 31.6 413.9
Resource Gains Type Count Total Average Overflow
leader_of_the_pack Health 39.41 0.00 (0.00%) 0.00 332966.21 100.00%
yseras_gift Health 4.01 0.00 (0.00%) 0.00 44369.55 100.00%
healing_touch Health 34.82 0.00 (0.00%) 0.00 970667.22 100.00%
glyph_of_ferocious_bite Health 13.95 0.00 (0.00%) 0.00 276232.48 100.00%
energy_regen Energy 1026.87 3527.65 (64.44%) 3.44 25.43 0.72%
external_healing Health 48.06 0.00 (0.00%) 0.00 390766.05 100.00%
mp5_regen Mana 1026.87 0.00 (0.00%) 0.00 153892.52 100.00%
omen_of_clarity Energy 20.25 747.48 (13.65%) 36.91 0.00 0.00%
primal_fury Combo Points 34.56 34.56 (23.00%) 1.00 0.00 0.00%
rake Combo Points 23.25 20.00 (13.31%) 0.86 3.25 13.98%
shred Combo Points 98.66 95.71 (63.69%) 0.97 2.95 2.99%
soul_of_the_forest Energy 31.02 585.48 (10.69%) 18.87 5.11 0.87%
tigers_fury Energy 10.23 613.77 (11.21%) 60.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Energy 15.71 15.92
Combo Points 0.50 0.49
Combat End Resource Mean Min Max
Mana 32000.00 32000.00 32000.00
Rage 0.00 0.00 0.00
Energy 21.59 0.02 100.00
Combo Points 2.62 0.00 5.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.1%
treant-Energy Cap 0.1%
treant-Energy Cap 0.1%
treant-Energy Cap 0.1%
treant-Energy Cap 0.1%

Procs

Count Interval
primal_fury 34.6 8.6sec

Statistics & Data Analysis

Fight Length
Sample Data Kernoris Fight Length
Count 25000
Mean 300.94
Minimum 230.43
Maximum 374.11
Spread ( max - min ) 143.68
Range [ ( max - min ) / 2 * 100% ] 23.87%
DPS
Sample Data Kernoris Damage Per Second
Count 25000
Mean 21374.52
Minimum 18724.18
Maximum 24663.87
Spread ( max - min ) 5939.68
Range [ ( max - min ) / 2 * 100% ] 13.89%
Standard Deviation 746.0058
5th Percentile 20215.98
95th Percentile 22669.36
( 95th Percentile - 5th Percentile ) 2453.38
Mean Distribution
Standard Deviation 4.7182
95.00% Confidence Intervall ( 21365.28 - 21383.77 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 46
0.1% Error 4679
0.1 Scale Factor Error with Delta=300 4750
0.05 Scale Factor Error with Delta=300 19003
0.01 Scale Factor Error with Delta=300 475081
Distribution Chart
DPS(e)
Sample Data Kernoris Damage Per Second (Effective)
Count 25000
Mean 21374.52
Minimum 18724.18
Maximum 24663.87
Spread ( max - min ) 5939.68
Range [ ( max - min ) / 2 * 100% ] 13.89%
Damage
Sample Data Kernoris Damage
Count 25000
Mean 6418050.32
Minimum 4758292.71
Maximum 8352382.78
Spread ( max - min ) 3594090.07
Range [ ( max - min ) / 2 * 100% ] 28.00%
DTPS
Sample Data Kernoris Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Kernoris Healing Per Second
Count 25000
Mean 124.22
Minimum 0.00
Maximum 1851.15
Spread ( max - min ) 1851.15
Range [ ( max - min ) / 2 * 100% ] 745.12%
Standard Deviation 458.6157
5th Percentile 0.00
95th Percentile 1808.15
( 95th Percentile - 5th Percentile ) 1808.15
Mean Distribution
Standard Deviation 2.9005
95.00% Confidence Intervall ( 118.53 - 129.90 )
Normalized 95.00% Confidence Intervall ( 95.42% - 104.58% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 523629
0.1% Error 52362997
0.1 Scale Factor Error with Delta=300 1795
0.05 Scale Factor Error with Delta=300 7181
0.01 Scale Factor Error with Delta=300 179548
Distribution Chart
HPS(e)
Sample Data Kernoris Healing Per Second (Effective)
Count 25000
Mean 124.22
Minimum 0.00
Maximum 1851.15
Spread ( max - min ) 1851.15
Range [ ( max - min ) / 2 * 100% ] 745.12%
Heal
Sample Data Kernoris Heal
Count 25000
Mean 37345.37
Minimum 0.00
Maximum 685207.20
Spread ( max - min ) 685207.20
Range [ ( max - min ) / 2 * 100% ] 917.39%
HTPS
Sample Data Kernoris Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Kernoris Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data KernorisTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Kernoris Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_agility_flask
1 0.00 food,type=blackrock_barbecue
2 0.00 mark_of_the_wild,if=!aura.str_agi_int.up
3 0.00 healing_touch,if=talent.bloodtalons.enabled
4 0.00 cat_form
5 0.00 prowl
6 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
7 0.00 potion,name=draenic_agility
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 cat_form
9 0.00 wild_charge
A 0.00 displacer_beast,if=movement.distance>10
B 0.00 dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
C 1.00 rake,if=buff.prowl.up
D 1.00 auto_attack
E 8.41 skull_bash
F 0.00 force_of_nature,if=charges=3|trinket.proc.all.react|target.time_to_die<20
G 0.88 potion,name=draenic_agility,if=target.time_to_die<=40
H 0.00 blood_fury,sync=tigers_fury
I 0.00 berserking,sync=tigers_fury
J 0.00 arcane_torrent,sync=tigers_fury
K 10.23 tigers_fury,if=(!buff.omen_of_clarity.react&energy.max-energy>=60)|energy.max-energy>=80
L 0.00 incarnation,if=cooldown.berserk.remains<10&energy.time_to_max>1
M 0.12 potion,name=draenic_agility,sync=berserk,if=target.health.pct<25
N 2.01 berserk,if=buff.tigers_fury.up
O 0.31 ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.health.pct<25
Keep Rip from falling off during execute range.
P 28.03 healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=4|buff.predatory_swiftness.remains<1.5)
Q 4.46 savage_roar,if=buff.savage_roar.remains<3
R 0.00 thrash_cat,cycle_targets=1,if=buff.omen_of_clarity.react&remains<4.5&active_enemies>1
S 0.00 thrash_cat,cycle_targets=1,if=!talent.bloodtalons.enabled&combo_points=5&remains<4.5&buff.omen_of_clarity.react
T 0.00 pool_resource,for_next=1
U 0.00 thrash_cat,cycle_targets=1,if=remains<4.5&active_enemies>1
V 0.00 call_action_list,name=finisher,if=combo_points=5
W 0.00 call_action_list,name=maintain
X 0.00 call_action_list,name=generator,if=combo_points<5
actions.finisher
# count action,conditions
Y 5.09 ferocious_bite,cycle_targets=1,max_energy=1,if=target.health.pct<25&dot.rip.ticking
Z 7.34 rip,cycle_targets=1,if=remains<3&target.time_to_die-remains>18
a 2.07 rip,cycle_targets=1,if=remains<7.2&persistent_multiplier>dot.rip.pmultiplier&target.time_to_die-remains>18
b 3.20 savage_roar,if=(energy.time_to_max<=1|buff.berserk.up|cooldown.tigers_fury.remains<3)&buff.savage_roar.remains<12.6
c 8.55 ferocious_bite,max_energy=1,if=(energy.time_to_max<=1|buff.berserk.up|cooldown.tigers_fury.remains<3)
actions.maintain
# count action,conditions
d 0.00 rake,cycle_targets=1,if=!talent.bloodtalons.enabled&remains<3&combo_points<5&((target.time_to_die-remains>3&active_enemies<3)|target.time_to_die-remains>6)
e 0.00 rake,cycle_targets=1,if=!talent.bloodtalons.enabled&remains<4.5&combo_points<5&persistent_multiplier>dot.rake.pmultiplier&((target.time_to_die-remains>3&active_enemies<3)|target.time_to_die-remains>6)
f 13.78 rake,cycle_targets=1,if=talent.bloodtalons.enabled&remains<4.5&combo_points<5&(!buff.predatory_swiftness.up|buff.bloodtalons.up|persistent_multiplier>dot.rake.pmultiplier)&((target.time_to_die-remains>3&active_enemies<3)|target.time_to_die-remains>6)
g 2.45 thrash_cat,cycle_targets=1,if=talent.bloodtalons.enabled&combo_points=5&remains<4.5&buff.omen_of_clarity.react
h 0.00 moonfire_cat,cycle_targets=1,if=combo_points<5&remains<4.2&active_enemies<6&target.time_to_die-remains>tick_time*5
i 8.47 rake,cycle_targets=1,if=persistent_multiplier>dot.rake.pmultiplier&combo_points<5&active_enemies=1
actions.generator
# count action,conditions
j 0.00 swipe,if=active_enemies>=3
k 98.66 shred,if=active_enemies<3

Sample Sequence

013457CDkkKNkEkZkkPkckkkkPfckkkPkakkkkPfgbkkKkPicEkkkkPZkkfPicKkkkPaikPkEQkkkPfcKkkkkPfZkkEkPfbkkkPkKZkkkkPfckkkPZfkEkPKibkkkPkgZkkfPickKNkkEkPcikkPakkkPbkkkPgcfkkKPiYkkEkPYfkPkbkkkKPYfkGkkPkYEkfkPikKYkkkkPQkk

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 32000.0/32000: 100% mana | 100.0/100: 100% rage | 100.0/100: 100% energy | 5.0/5: 100% combo_points
Pre food Fluffy_Pillow 32000.0/32000: 100% mana | 100.0/100: 100% rage | 100.0/100: 100% energy | 5.0/5: 100% combo_points
Pre healing_touch Kernoris 32000.0/32000: 100% mana | 100.0/100: 100% rage | 100.0/100: 100% energy | 5.0/5: 100% combo_points bloodtalons(2)
Pre cat_form Fluffy_Pillow 32000.0/32000: 100% mana | 100.0/100: 100% rage | 100.0/100: 100% energy | 5.0/5: 100% combo_points bloodtalons(2)
Pre prowl Fluffy_Pillow 32000.0/32000: 100% mana | 100.0/100: 100% rage | 100.0/100: 100% energy | 5.0/5: 100% combo_points bloodtalons(2)
Pre potion Fluffy_Pillow 32000.0/32000: 100% mana | 100.0/100: 100% rage | 100.0/100: 100% energy | 5.0/5: 100% combo_points bloodtalons(2), draenic_agility_potion
0:00.000 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodtalons(2), draenic_agility_potion
0:00.000 auto_attack Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 65.0/100: 65% energy | 1.0/5: 20% combo_points bloodtalons, draenic_agility_potion
0:01.005 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 79.8/100: 80% energy | 1.0/5: 20% combo_points bloodlust, bloodtalons, draenic_agility_potion
0:02.008 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 54.7/100: 55% energy | 2.0/5: 40% combo_points bloodlust, draenic_agility_potion
0:03.011 tigers_fury Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 29.5/100: 29% energy | 3.0/5: 60% combo_points bloodlust, draenic_agility_potion
0:03.011 berserk Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 89.5/100: 89% energy | 3.0/5: 60% combo_points bloodlust, tigers_fury, draenic_agility_potion
0:03.011 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 89.5/150: 60% energy | 3.0/5: 60% combo_points bloodlust, berserk, tigers_fury, draenic_agility_potion
0:04.015 skull_bash Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 84.3/150: 56% energy | 4.0/5: 80% combo_points bloodlust, berserk, omen_of_clarity, tigers_fury, draenic_agility_potion
0:04.015 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 84.3/150: 56% energy | 4.0/5: 80% combo_points bloodlust, berserk, omen_of_clarity, tigers_fury, draenic_agility_potion
0:05.020 rip Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 99.1/150: 66% energy | 5.0/5: 100% combo_points bloodlust, berserk, tigers_fury, draenic_agility_potion
0:06.024 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 119.0/150: 79% energy | 0.0/5: 0% combo_points bloodlust, berserk, tigers_fury, predatory_swiftness, draenic_agility_potion
0:07.028 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 113.8/150: 76% energy | 2.0/5: 40% combo_points bloodlust, berserk, tigers_fury, predatory_swiftness, draenic_agility_potion
0:08.033 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 108.6/150: 72% energy | 4.0/5: 80% combo_points bloodlust, berserk, tigers_fury, predatory_swiftness, draenic_agility_potion
0:09.039 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 123.5/150: 82% energy | 4.0/5: 80% combo_points bloodlust, berserk, bloodtalons(2), tigers_fury, draenic_agility_potion
0:10.044 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 118.3/150: 79% energy | 5.0/5: 100% combo_points bloodlust, berserk, bloodtalons, tigers_fury, draenic_agility_potion
0:11.049 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 128.2/150: 85% energy | 0.0/5: 0% combo_points bloodlust, berserk, omen_of_clarity, predatory_swiftness, draenic_agility_potion
0:12.055 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 143.0/150: 95% energy | 1.0/5: 20% combo_points bloodlust, berserk, omen_of_clarity, predatory_swiftness, draenic_agility_potion
0:13.060 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 150.0/150: 100% energy | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, draenic_agility_potion
0:14.064 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 144.8/150: 97% energy | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, draenic_agility_potion
0:15.068 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 139.7/150: 93% energy | 4.0/5: 80% combo_points bloodlust, berserk, predatory_swiftness, draenic_agility_potion
0:16.073 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 150.0/150: 100% energy | 4.0/5: 80% combo_points bloodlust, berserk, bloodtalons(2), draenic_agility_potion
0:17.077 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 147.3/150: 98% energy | 5.0/5: 100% combo_points bloodlust, berserk, omen_of_clarity, bloodtalons, draenic_agility_potion
0:18.080 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, predatory_swiftness, draenic_agility_potion
0:19.086 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 74.9/100: 75% energy | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, draenic_agility_potion
0:20.090 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 49.7/100: 50% energy | 3.0/5: 60% combo_points bloodlust, predatory_swiftness
0:21.094 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 24.5/100: 25% energy | 4.0/5: 80% combo_points bloodlust, predatory_swiftness
0:22.099 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 39.4/100: 39% energy | 4.0/5: 80% combo_points bloodlust, omen_of_clarity, bloodtalons(2)
0:23.102 rip Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 54.2/100: 54% energy | 5.0/5: 100% combo_points bloodlust, bloodtalons
0:24.106 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 59.0/100: 59% energy | 0.0/5: 0% combo_points bloodlust, predatory_swiftness
0:25.110 Waiting 0.500 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 33.8/100: 34% energy | 1.0/5: 20% combo_points bloodlust, predatory_swiftness
0:25.610 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 41.2/100: 41% energy | 1.0/5: 20% combo_points bloodlust, predatory_swiftness
0:26.615 Waiting 0.705 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 16.1/100: 16% energy | 2.0/5: 40% combo_points bloodlust, predatory_swiftness
0:27.320 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 26.5/100: 26% energy | 2.0/5: 40% combo_points bloodlust, omen_of_clarity, predatory_swiftness
0:28.323 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 41.3/100: 41% energy | 3.0/5: 60% combo_points bloodlust, predatory_swiftness
0:29.329 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 16.1/100: 16% energy | 4.0/5: 80% combo_points bloodlust, predatory_swiftness
0:30.333 Waiting 0.300 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 31.0/100: 31% energy | 4.0/5: 80% combo_points bloodlust, bloodtalons(2)
0:30.633 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 35.4/100: 35% energy | 4.0/5: 80% combo_points bloodlust, bloodtalons(2)
0:31.638 thrash_cat Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 15.2/100: 15% energy | 5.0/5: 100% combo_points bloodlust, omen_of_clarity, bloodtalons
0:32.643 savage_roar Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 30.1/100: 30% energy | 5.0/5: 100% combo_points bloodlust
0:33.648 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 39.9/100: 40% energy | 0.0/5: 0% combo_points bloodlust, omen_of_clarity, predatory_swiftness
0:34.654 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 54.8/100: 55% energy | 1.0/5: 20% combo_points bloodlust, predatory_swiftness
0:35.658 tigers_fury Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 29.6/100: 30% energy | 3.0/5: 60% combo_points bloodlust, predatory_swiftness
0:35.658 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 89.6/100: 90% energy | 3.0/5: 60% combo_points bloodlust, tigers_fury, predatory_swiftness
0:36.662 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 64.4/100: 64% energy | 4.0/5: 80% combo_points bloodlust, tigers_fury, predatory_swiftness
0:37.667 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 79.3/100: 79% energy | 4.0/5: 80% combo_points bloodlust, bloodtalons(2), tigers_fury
0:38.672 Waiting 1.800 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 59.1/100: 59% energy | 5.0/5: 100% combo_points bloodlust, bloodtalons, tigers_fury
0:40.472 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 85.7/100: 86% energy | 5.0/5: 100% combo_points bloodlust, bloodtalons, tigers_fury
0:41.476 skull_bash Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 67.1/100: 67% energy | 0.0/5: 0% combo_points tigers_fury, predatory_swiftness
0:41.476 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 67.1/100: 67% energy | 0.0/5: 0% combo_points tigers_fury, predatory_swiftness
0:42.482 Waiting 0.200 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 38.5/100: 39% energy | 1.0/5: 20% combo_points tigers_fury, predatory_swiftness
0:42.682 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.8/100: 41% energy | 1.0/5: 20% combo_points tigers_fury, predatory_swiftness
0:43.687 Waiting 2.323 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.2/100: 12% energy | 2.0/5: 40% combo_points predatory_swiftness
0:46.010 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 38.6/100: 39% energy | 2.0/5: 40% combo_points omen_of_clarity, predatory_swiftness
0:47.015 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 50.0/100: 50% energy | 3.0/5: 60% combo_points predatory_swiftness
0:48.019 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 21.5/100: 21% energy | 5.0/5: 100% combo_points predatory_swiftness
0:49.025 Waiting 1.000 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 32.9/100: 33% energy | 5.0/5: 100% combo_points bloodtalons(2)
0:50.025 rip Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 44.2/100: 44% energy | 5.0/5: 100% combo_points bloodtalons(2)
0:51.030 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 45.7/100: 46% energy | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
0:52.034 Waiting 2.097 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 17.1/100: 17% energy | 1.0/5: 20% combo_points predatory_swiftness
0:54.131 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 1.0/5: 20% combo_points predatory_swiftness
0:55.136 Waiting 2.116 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 2.0/5: 40% combo_points predatory_swiftness
0:57.252 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 36.4/100: 36% energy | 2.0/5: 40% combo_points predatory_swiftness
0:58.257 Waiting 2.276 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.8/100: 13% energy | 3.0/5: 60% combo_points predatory_swiftness
1:00.533 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 38.6/100: 39% energy | 3.0/5: 60% combo_points predatory_swiftness
1:01.538 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 50.0/100: 50% energy | 3.0/5: 60% combo_points bloodtalons(2)
1:02.542 Waiting 2.100 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 26.5/100: 26% energy | 5.0/5: 100% combo_points bloodtalons
1:04.642 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 50.3/100: 50% energy | 5.0/5: 100% combo_points bloodtalons
1:05.647 Waiting 0.100 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 31.7/100: 32% energy | 0.0/5: 0% combo_points predatory_swiftness
1:05.747 tigers_fury Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 32.9/100: 33% energy | 0.0/5: 0% combo_points predatory_swiftness
1:05.747 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 92.9/100: 93% energy | 0.0/5: 0% combo_points tigers_fury, predatory_swiftness
1:06.752 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 64.3/100: 64% energy | 1.0/5: 20% combo_points tigers_fury, predatory_swiftness
1:07.755 Waiting 0.200 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 35.7/100: 36% energy | 3.0/5: 60% combo_points tigers_fury, predatory_swiftness
1:07.955 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 37.9/100: 38% energy | 3.0/5: 60% combo_points omen_of_clarity, tigers_fury, predatory_swiftness
1:08.959 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 49.4/100: 49% energy | 5.0/5: 100% combo_points tigers_fury, predatory_swiftness
1:09.963 rip Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 60.8/100: 61% energy | 5.0/5: 100% combo_points bloodtalons(2), tigers_fury
1:10.967 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 62.2/100: 62% energy | 0.0/5: 0% combo_points bloodtalons, tigers_fury, predatory_swiftness
1:11.972 Waiting 0.200 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 38.6/100: 39% energy | 2.0/5: 40% combo_points tigers_fury, predatory_swiftness
1:12.172 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 2.0/5: 40% combo_points tigers_fury, predatory_swiftness
1:13.175 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 4.0/5: 80% combo_points tigers_fury, predatory_swiftness
1:14.179 Waiting 1.518 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.7/100: 24% energy | 4.0/5: 80% combo_points bloodtalons(2)
1:15.697 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 4.0/5: 80% combo_points bloodtalons(2)
1:16.703 Waiting 1.414 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 5.0/5: 100% combo_points bloodtalons
1:18.117 skull_bash Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 28.4/100: 28% energy | 5.0/5: 100% combo_points bloodtalons
1:18.117 Waiting 2.900 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 28.4/100: 28% energy | 5.0/5: 100% combo_points bloodtalons
1:21.017 savage_roar Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 61.3/100: 61% energy | 5.0/5: 100% combo_points bloodtalons
1:22.022 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 67.8/100: 68% energy | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
1:23.026 Waiting 0.100 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 39.2/100: 39% energy | 2.0/5: 40% combo_points predatory_swiftness
1:23.126 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.3/100: 40% energy | 2.0/5: 40% combo_points predatory_swiftness
1:24.132 Waiting 2.567 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.7/100: 12% energy | 3.0/5: 60% combo_points predatory_swiftness
1:26.699 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 3.0/5: 60% combo_points predatory_swiftness
1:27.703 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 4.0/5: 80% combo_points predatory_swiftness
1:28.708 Waiting 1.012 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.7/100: 24% energy | 4.0/5: 80% combo_points bloodtalons(2)
1:29.720 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 35.2/100: 35% energy | 4.0/5: 80% combo_points bloodtalons(2)
1:30.724 Waiting 3.477 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.6/100: 12% energy | 5.0/5: 100% combo_points bloodtalons
1:34.201 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 51.1/100: 51% energy | 5.0/5: 100% combo_points bloodtalons
1:35.205 Waiting 0.600 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 32.5/100: 33% energy | 0.0/5: 0% combo_points predatory_swiftness
1:35.805 tigers_fury Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 39.4/100: 39% energy | 0.0/5: 0% combo_points predatory_swiftness
1:35.805 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 99.4/100: 99% energy | 0.0/5: 0% combo_points tigers_fury, predatory_swiftness
1:36.809 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 70.8/100: 71% energy | 1.0/5: 20% combo_points tigers_fury, predatory_swiftness
1:37.814 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 42.2/100: 42% energy | 2.0/5: 40% combo_points tigers_fury, predatory_swiftness
1:38.819 Waiting 2.403 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 13.6/100: 14% energy | 3.0/5: 60% combo_points tigers_fury, predatory_swiftness
1:41.222 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 3.0/5: 60% combo_points tigers_fury, predatory_swiftness
1:42.226 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 4.0/5: 80% combo_points tigers_fury, predatory_swiftness
1:43.232 Waiting 1.011 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.7/100: 24% energy | 4.0/5: 80% combo_points bloodtalons(2), tigers_fury
1:44.243 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 35.2/100: 35% energy | 4.0/5: 80% combo_points bloodtalons(2)
1:45.246 Waiting 1.678 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.6/100: 12% energy | 5.0/5: 100% combo_points bloodtalons
1:46.924 rip Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 30.7/100: 31% energy | 5.0/5: 100% combo_points bloodtalons
1:47.929 Waiting 0.700 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 32.1/100: 32% energy | 0.0/5: 0% combo_points predatory_swiftness
1:48.629 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.0/100: 40% energy | 0.0/5: 0% combo_points predatory_swiftness
1:49.632 Waiting 2.593 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.4/100: 11% energy | 1.0/5: 20% combo_points predatory_swiftness
1:52.225 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 1.0/5: 20% combo_points predatory_swiftness
1:53.229 Waiting 2.317 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 2.0/5: 40% combo_points predatory_swiftness
1:55.546 skull_bash Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 38.6/100: 39% energy | 2.0/5: 40% combo_points predatory_swiftness
1:55.546 Waiting 0.200 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 38.6/100: 39% energy | 2.0/5: 40% combo_points predatory_swiftness
1:55.746 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 2.0/5: 40% combo_points predatory_swiftness
1:56.750 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 4.0/5: 80% combo_points predatory_swiftness
1:57.755 Waiting 1.012 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.7/100: 24% energy | 4.0/5: 80% combo_points bloodtalons(2)
1:58.767 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 35.2/100: 35% energy | 4.0/5: 80% combo_points bloodtalons(2)
1:59.773 Waiting 3.074 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.7/100: 12% energy | 5.0/5: 100% combo_points bloodtalons
2:02.847 savage_roar Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 46.6/100: 47% energy | 5.0/5: 100% combo_points omen_of_clarity, bloodtalons
2:03.851 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 53.0/100: 53% energy | 0.0/5: 0% combo_points omen_of_clarity, bloodtalons, predatory_swiftness
2:04.854 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 64.4/100: 64% energy | 2.0/5: 40% combo_points omen_of_clarity, predatory_swiftness
2:05.859 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 75.8/100: 76% energy | 3.0/5: 60% combo_points predatory_swiftness
2:06.862 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 47.2/100: 47% energy | 4.0/5: 80% combo_points predatory_swiftness
2:07.866 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 58.6/100: 59% energy | 4.0/5: 80% combo_points bloodtalons(2)
2:08.872 tigers_fury Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 30.0/100: 30% energy | 5.0/5: 100% combo_points bloodtalons
2:08.872 rip Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 90.0/100: 90% energy | 5.0/5: 100% combo_points bloodtalons, tigers_fury
2:09.876 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 91.4/100: 91% energy | 0.0/5: 0% combo_points tigers_fury, predatory_swiftness
2:10.881 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 62.9/100: 63% energy | 1.0/5: 20% combo_points omen_of_clarity, tigers_fury, predatory_swiftness
2:11.886 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 74.3/100: 74% energy | 2.0/5: 40% combo_points tigers_fury, predatory_swiftness
2:12.890 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 45.7/100: 46% energy | 3.0/5: 60% combo_points omen_of_clarity, tigers_fury, predatory_swiftness
2:13.895 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 57.1/100: 57% energy | 4.0/5: 80% combo_points tigers_fury, predatory_swiftness
2:14.900 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 68.5/100: 69% energy | 4.0/5: 80% combo_points bloodtalons(2), tigers_fury
2:15.905 Waiting 3.900 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 44.9/100: 45% energy | 5.0/5: 100% combo_points bloodtalons, tigers_fury
2:19.805 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 89.2/100: 89% energy | 5.0/5: 100% combo_points bloodtalons
2:20.811 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 70.7/100: 71% energy | 0.0/5: 0% combo_points predatory_swiftness
2:21.814 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 42.1/100: 42% energy | 2.0/5: 40% combo_points predatory_swiftness
2:22.819 Waiting 2.414 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 13.5/100: 13% energy | 3.0/5: 60% combo_points predatory_swiftness
2:25.233 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 3.0/5: 60% combo_points predatory_swiftness
2:26.238 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 5.0/5: 100% combo_points predatory_swiftness
2:27.244 Waiting 4.709 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.8/100: 24% energy | 5.0/5: 100% combo_points bloodtalons(2)
2:31.953 rip Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 77.2/100: 77% energy | 5.0/5: 100% combo_points bloodtalons(2)
2:32.958 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 78.7/100: 79% energy | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
2:33.964 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 55.1/100: 55% energy | 1.0/5: 20% combo_points predatory_swiftness
2:34.969 skull_bash Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 26.5/100: 27% energy | 2.0/5: 40% combo_points predatory_swiftness
2:34.969 Waiting 1.200 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 26.5/100: 27% energy | 2.0/5: 40% combo_points predatory_swiftness
2:36.169 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.1/100: 40% energy | 2.0/5: 40% combo_points predatory_swiftness
2:37.172 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.5/100: 12% energy | 4.0/5: 80% combo_points predatory_swiftness
2:38.175 Waiting 0.781 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 22.9/100: 23% energy | 4.0/5: 80% combo_points bloodtalons(2)
2:38.956 tigers_fury Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 31.8/100: 32% energy | 4.0/5: 80% combo_points bloodtalons(2)
2:38.956 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 91.8/100: 92% energy | 4.0/5: 80% combo_points bloodtalons(2), tigers_fury
2:39.959 Waiting 1.800 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 68.2/100: 68% energy | 5.0/5: 100% combo_points bloodtalons, tigers_fury
2:41.759 savage_roar Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 88.7/100: 89% energy | 5.0/5: 100% combo_points bloodtalons, tigers_fury
2:42.763 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 95.1/100: 95% energy | 0.0/5: 0% combo_points bloodtalons, tigers_fury, predatory_swiftness
2:43.768 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 66.5/100: 66% energy | 2.0/5: 40% combo_points tigers_fury, predatory_swiftness
2:44.773 Waiting 0.200 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 37.9/100: 38% energy | 3.0/5: 60% combo_points tigers_fury, predatory_swiftness
2:44.973 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.2/100: 40% energy | 3.0/5: 60% combo_points tigers_fury, predatory_swiftness
2:45.979 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.6/100: 12% energy | 4.0/5: 80% combo_points tigers_fury, predatory_swiftness
2:46.984 Waiting 1.574 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.0/100: 23% energy | 4.0/5: 80% combo_points bloodtalons(2)
2:48.558 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 4.0/5: 80% combo_points bloodtalons(2)
2:49.564 Waiting 1.315 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 5.0/5: 100% combo_points bloodtalons
2:50.879 thrash_cat Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 27.3/100: 27% energy | 5.0/5: 100% combo_points omen_of_clarity, bloodtalons
2:51.883 Waiting 4.100 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 38.7/100: 39% energy | 5.0/5: 100% combo_points
2:55.983 rip Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 85.3/100: 85% energy | 5.0/5: 100% combo_points
2:56.987 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 86.7/100: 87% energy | 0.0/5: 0% combo_points predatory_swiftness
2:57.989 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 58.0/100: 58% energy | 1.0/5: 20% combo_points predatory_swiftness
2:58.993 Waiting 0.500 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 29.5/100: 29% energy | 3.0/5: 60% combo_points predatory_swiftness
2:59.493 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 35.1/100: 35% energy | 3.0/5: 60% combo_points predatory_swiftness
3:00.498 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.5/100: 12% energy | 4.0/5: 80% combo_points predatory_swiftness
3:01.503 Waiting 1.078 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.0/100: 23% energy | 4.0/5: 80% combo_points bloodtalons(2)
3:02.581 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 35.2/100: 35% energy | 4.0/5: 80% combo_points bloodtalons(2)
3:03.588 Waiting 3.474 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.7/100: 12% energy | 5.0/5: 100% combo_points bloodtalons
3:07.062 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 51.1/100: 51% energy | 5.0/5: 100% combo_points bloodtalons
3:08.067 Waiting 0.700 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 32.5/100: 33% energy | 0.0/5: 0% combo_points predatory_swiftness
3:08.767 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.5/100: 40% energy | 0.0/5: 0% combo_points predatory_swiftness
3:09.772 tigers_fury Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.9/100: 12% energy | 1.0/5: 20% combo_points omen_of_clarity, predatory_swiftness
3:09.772 berserk Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 71.9/100: 72% energy | 1.0/5: 20% combo_points omen_of_clarity, tigers_fury, predatory_swiftness
3:09.772 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 71.9/150: 48% energy | 1.0/5: 20% combo_points berserk, omen_of_clarity, tigers_fury, predatory_swiftness
3:10.778 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 83.3/150: 56% energy | 2.0/5: 40% combo_points berserk, tigers_fury, predatory_swiftness
3:11.783 skull_bash Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 74.8/150: 50% energy | 3.0/5: 60% combo_points berserk, tigers_fury, predatory_swiftness
3:11.783 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 74.8/150: 50% energy | 3.0/5: 60% combo_points berserk, tigers_fury, predatory_swiftness
3:12.786 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 66.2/150: 44% energy | 5.0/5: 100% combo_points berserk, tigers_fury, predatory_swiftness
3:13.790 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 77.6/150: 52% energy | 5.0/5: 100% combo_points berserk, bloodtalons(2), tigers_fury
3:14.794 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 84.0/150: 56% energy | 0.0/5: 0% combo_points berserk, bloodtalons, tigers_fury, predatory_swiftness
3:15.798 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 77.9/150: 52% energy | 1.0/5: 20% combo_points berserk, tigers_fury, predatory_swiftness
3:16.801 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 69.3/150: 46% energy | 3.0/5: 60% combo_points berserk, omen_of_clarity, tigers_fury, predatory_swiftness
3:17.806 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 80.7/150: 54% energy | 5.0/5: 100% combo_points berserk, predatory_swiftness
3:18.809 rip Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 92.1/150: 61% energy | 5.0/5: 100% combo_points berserk, bloodtalons(2)
3:19.813 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 108.5/150: 72% energy | 0.0/5: 0% combo_points berserk, bloodtalons, predatory_swiftness
3:20.818 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 99.9/150: 67% energy | 2.0/5: 40% combo_points berserk, predatory_swiftness
3:21.822 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 91.3/150: 61% energy | 3.0/5: 60% combo_points berserk, predatory_swiftness
3:22.826 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 82.7/150: 55% energy | 5.0/5: 100% combo_points berserk, predatory_swiftness
3:23.832 savage_roar Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 94.1/150: 63% energy | 5.0/5: 100% combo_points berserk, bloodtalons(2)
3:24.837 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness
3:25.842 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 71.4/100: 71% energy | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness
3:26.845 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 42.8/100: 43% energy | 3.0/5: 60% combo_points predatory_swiftness
3:27.849 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 14.2/100: 14% energy | 5.0/5: 100% combo_points omen_of_clarity, predatory_swiftness
3:28.854 thrash_cat Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 25.6/100: 26% energy | 5.0/5: 100% combo_points omen_of_clarity, bloodtalons(2)
3:29.858 Waiting 4.600 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 37.0/100: 37% energy | 5.0/5: 100% combo_points bloodtalons
3:34.458 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 89.3/100: 89% energy | 5.0/5: 100% combo_points bloodtalons
3:35.462 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 70.7/100: 71% energy | 0.0/5: 0% combo_points predatory_swiftness
3:36.466 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 47.1/100: 47% energy | 1.0/5: 20% combo_points predatory_swiftness
3:37.472 Waiting 1.968 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 18.5/100: 19% energy | 3.0/5: 60% combo_points predatory_swiftness
3:39.440 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 3.0/5: 60% combo_points predatory_swiftness
3:40.445 tigers_fury Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 4.0/5: 80% combo_points predatory_swiftness
3:40.445 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 72.3/100: 72% energy | 4.0/5: 80% combo_points tigers_fury, predatory_swiftness
3:41.451 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 83.8/100: 84% energy | 4.0/5: 80% combo_points bloodtalons(2), tigers_fury
3:42.454 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 60.1/100: 60% energy | 5.0/5: 100% combo_points bloodtalons, tigers_fury
3:43.460 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 41.6/100: 42% energy | 0.0/5: 0% combo_points tigers_fury, predatory_swiftness
3:44.465 Waiting 2.456 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 13.0/100: 13% energy | 2.0/5: 40% combo_points tigers_fury, predatory_swiftness
3:46.921 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 2.0/5: 40% combo_points tigers_fury, predatory_swiftness
3:47.928 Waiting 1.214 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 3.0/5: 60% combo_points tigers_fury, predatory_swiftness
3:49.142 skull_bash Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 26.1/100: 26% energy | 3.0/5: 60% combo_points predatory_swiftness
3:49.142 Waiting 1.300 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 26.1/100: 26% energy | 3.0/5: 60% combo_points predatory_swiftness
3:50.442 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 3.0/5: 60% combo_points predatory_swiftness
3:51.445 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 5.0/5: 100% combo_points predatory_swiftness
3:52.448 Waiting 2.415 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.7/100: 24% energy | 5.0/5: 100% combo_points bloodtalons(2)
3:54.863 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 51.1/100: 51% energy | 5.0/5: 100% combo_points bloodtalons(2)
3:55.866 Waiting 0.600 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 32.5/100: 33% energy | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
3:56.466 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 39.3/100: 39% energy | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
3:57.471 Waiting 2.213 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 15.8/100: 16% energy | 2.0/5: 40% combo_points predatory_swiftness
3:59.684 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 2.0/5: 40% combo_points predatory_swiftness
4:00.687 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 4.0/5: 80% combo_points predatory_swiftness
4:01.692 Waiting 1.513 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.7/100: 24% energy | 4.0/5: 80% combo_points bloodtalons(2)
4:03.205 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 4.0/5: 80% combo_points bloodtalons(2)
4:04.209 Waiting 3.317 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 5.0/5: 100% combo_points bloodtalons
4:07.526 savage_roar Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 50.0/100: 50% energy | 5.0/5: 100% combo_points bloodtalons
4:08.530 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 56.4/100: 56% energy | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
4:09.534 Waiting 0.600 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 27.8/100: 28% energy | 1.0/5: 20% combo_points predatory_swiftness
4:10.134 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 34.6/100: 35% energy | 1.0/5: 20% combo_points omen_of_clarity, predatory_swiftness
4:11.140 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 46.0/100: 46% energy | 3.0/5: 60% combo_points predatory_swiftness
4:12.145 tigers_fury Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 17.5/100: 17% energy | 5.0/5: 100% combo_points predatory_swiftness
4:12.145 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 77.5/100: 77% energy | 5.0/5: 100% combo_points tigers_fury, predatory_swiftness
4:13.148 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 88.9/100: 89% energy | 5.0/5: 100% combo_points bloodtalons(2), tigers_fury
4:14.151 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 70.3/100: 70% energy | 0.0/5: 0% combo_points bloodtalons, tigers_fury, predatory_swiftness
4:15.156 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 46.7/100: 47% energy | 1.0/5: 20% combo_points tigers_fury, predatory_swiftness
4:16.160 Waiting 1.509 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 18.1/100: 18% energy | 2.0/5: 40% combo_points tigers_fury, predatory_swiftness
4:17.669 potion Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 35.2/100: 35% energy | 2.0/5: 40% combo_points tigers_fury, predatory_swiftness
4:17.669 Waiting 0.500 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 35.2/100: 35% energy | 2.0/5: 40% combo_points tigers_fury, predatory_swiftness, draenic_agility_potion
4:18.169 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 2.0/5: 40% combo_points tigers_fury, predatory_swiftness, draenic_agility_potion
4:19.173 Waiting 2.516 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 3.0/5: 60% combo_points tigers_fury, predatory_swiftness, draenic_agility_potion
4:21.689 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 3.0/5: 60% combo_points predatory_swiftness, draenic_agility_potion
4:22.693 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 4.0/5: 80% combo_points predatory_swiftness, draenic_agility_potion
4:23.695 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.7/100: 24% energy | 4.0/5: 80% combo_points omen_of_clarity, bloodtalons(2), draenic_agility_potion
4:24.699 Waiting 1.400 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 35.1/100: 35% energy | 5.0/5: 100% combo_points bloodtalons, draenic_agility_potion
4:26.099 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 51.0/100: 51% energy | 5.0/5: 100% combo_points bloodtalons, draenic_agility_potion
4:27.104 skull_bash Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 32.4/100: 32% energy | 0.0/5: 0% combo_points predatory_swiftness, draenic_agility_potion
4:27.104 Waiting 0.700 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 32.4/100: 32% energy | 0.0/5: 0% combo_points predatory_swiftness, draenic_agility_potion
4:27.804 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.4/100: 40% energy | 0.0/5: 0% combo_points predatory_swiftness, draenic_agility_potion
4:28.810 Waiting 2.162 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.8/100: 12% energy | 1.0/5: 20% combo_points predatory_swiftness, draenic_agility_potion
4:30.972 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 36.4/100: 36% energy | 1.0/5: 20% combo_points predatory_swiftness, draenic_agility_potion
4:31.977 Waiting 2.475 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.8/100: 13% energy | 2.0/5: 40% combo_points predatory_swiftness, draenic_agility_potion
4:34.452 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 2.0/5: 40% combo_points predatory_swiftness, draenic_agility_potion
4:35.457 Waiting 1.216 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 3.0/5: 60% combo_points predatory_swiftness, draenic_agility_potion
4:36.673 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 26.1/100: 26% energy | 3.0/5: 60% combo_points predatory_swiftness, draenic_agility_potion
4:37.679 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 37.6/100: 38% energy | 3.0/5: 60% combo_points bloodtalons(2), draenic_agility_potion
4:38.683 Waiting 2.371 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 14.0/100: 14% energy | 4.0/5: 80% combo_points bloodtalons, draenic_agility_potion
4:41.054 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 4.0/5: 80% combo_points bloodtalons, draenic_agility_potion
4:42.058 Waiting 1.117 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 5.0/5: 100% combo_points draenic_agility_potion
4:43.175 tigers_fury Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 25.0/100: 25% energy | 5.0/5: 100% combo_points
4:43.175 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 85.0/100: 85% energy | 5.0/5: 100% combo_points tigers_fury
4:44.180 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 66.4/100: 66% energy | 0.0/5: 0% combo_points tigers_fury, predatory_swiftness
4:45.182 Waiting 0.200 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 37.8/100: 38% energy | 1.0/5: 20% combo_points tigers_fury, predatory_swiftness
4:45.382 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.1/100: 40% energy | 1.0/5: 20% combo_points tigers_fury, predatory_swiftness
4:46.386 Waiting 1.590 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.5/100: 11% energy | 2.0/5: 40% combo_points tigers_fury, predatory_swiftness
4:47.976 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 29.5/100: 30% energy | 2.0/5: 40% combo_points omen_of_clarity, tigers_fury, predatory_swiftness
4:48.981 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 41.0/100: 41% energy | 3.0/5: 60% combo_points tigers_fury, predatory_swiftness
4:49.985 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.4/100: 12% energy | 5.0/5: 100% combo_points tigers_fury, predatory_swiftness
4:50.988 Waiting 0.209 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.8/100: 24% energy | 5.0/5: 100% combo_points bloodtalons(2), tigers_fury
4:51.197 savage_roar Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 26.1/100: 26% energy | 5.0/5: 100% combo_points bloodtalons(2)
4:52.202 Waiting 0.700 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 32.6/100: 33% energy | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness
4:52.902 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.5/100: 41% energy | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness
4:53.906 Waiting 1.151 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.9/100: 12% energy | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness
4:55.057 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 25.0/100: 25% energy | 1.0/5: 20% combo_points omen_of_clarity, bloodtalons, predatory_swiftness

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 660 629 629
Agility 4047 3591 3485 (1238)
Stamina 3911 3556 3556
Intellect 1089 1038 1038
Spirit 781 781 781
Health 234660 213360 0
Mana 32000 32000 0
Rage 100 100 0
Energy 100 100 0
Combo Points 5 5 0
Crit 31.35% 25.40% 1034
Haste 13.61% 8.20% 820
Multistrike 9.95% 4.95% 327
Damage / Heal Versatility 5.56% 2.56% 333
ManaReg per Second 512 512 0
Attack Power 4452 3591 0
Mastery 50.24% 34.59% 335
Armor 827 827 827
Run Speed 0 0 95

Talents

Level
15 Feline Swiftness Displacer Beast Wild Charge
30 Ysera's Gift Renewal Cenarion Ward
45 Faerie Swarm (Feral Druid) Mass Entanglement Typhoon
60 Soul of the Forest (Feral Druid) Incarnation: King of the Jungle (Feral Druid) Force of Nature (Feral Druid)
75 Incapacitating Roar Ursol's Vortex Mighty Bash
90 Heart of the Wild (Feral Druid) Dream of Cenarius (Feral Druid) Nature's Vigil
100 Lunar Inspiration (Feral Druid) Bloodtalons (Feral Druid) Claws of Shirvallah (Feral Druid)

Profile

druid="Kernoris"
origin="http://eu.battle.net/wow/en/character/forscherliga/Kernoris/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/20/55011348-avatar.jpg"
level=100
race=worgen
role=attack
position=back
professions=alchemy=700/herbalism=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#UZ!2020211
glyphs=savage_roar/cat_form/ferocious_bite/grace/travel/aquatic_form
spec=feral

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_agility_flask
actions.precombat+=/food,type=blackrock_barbecue
actions.precombat+=/mark_of_the_wild,if=!aura.str_agi_int.up
actions.precombat+=/healing_touch,if=talent.bloodtalons.enabled
actions.precombat+=/cat_form
actions.precombat+=/prowl
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=draenic_agility

# Executed every time the actor is available.

actions=cat_form
actions+=/wild_charge
actions+=/displacer_beast,if=movement.distance>10
actions+=/dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
actions+=/rake,if=buff.prowl.up
actions+=/auto_attack
actions+=/skull_bash
actions+=/force_of_nature,if=charges=3|trinket.proc.all.react|target.time_to_die<20
actions+=/potion,name=draenic_agility,if=target.time_to_die<=40
actions+=/blood_fury,sync=tigers_fury
actions+=/berserking,sync=tigers_fury
actions+=/arcane_torrent,sync=tigers_fury
actions+=/tigers_fury,if=(!buff.omen_of_clarity.react&energy.max-energy>=60)|energy.max-energy>=80
actions+=/incarnation,if=cooldown.berserk.remains<10&energy.time_to_max>1
actions+=/potion,name=draenic_agility,sync=berserk,if=target.health.pct<25
actions+=/berserk,if=buff.tigers_fury.up
# Keep Rip from falling off during execute range.
actions+=/ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.health.pct<25
actions+=/healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=4|buff.predatory_swiftness.remains<1.5)
actions+=/savage_roar,if=buff.savage_roar.remains<3
actions+=/thrash_cat,cycle_targets=1,if=buff.omen_of_clarity.react&remains<4.5&active_enemies>1
actions+=/thrash_cat,cycle_targets=1,if=!talent.bloodtalons.enabled&combo_points=5&remains<4.5&buff.omen_of_clarity.react
actions+=/pool_resource,for_next=1
actions+=/thrash_cat,cycle_targets=1,if=remains<4.5&active_enemies>1
actions+=/call_action_list,name=finisher,if=combo_points=5
actions+=/call_action_list,name=maintain
actions+=/call_action_list,name=generator,if=combo_points<5

actions.finisher=ferocious_bite,cycle_targets=1,max_energy=1,if=target.health.pct<25&dot.rip.ticking
actions.finisher+=/rip,cycle_targets=1,if=remains<3&target.time_to_die-remains>18
actions.finisher+=/rip,cycle_targets=1,if=remains<7.2&persistent_multiplier>dot.rip.pmultiplier&target.time_to_die-remains>18
actions.finisher+=/savage_roar,if=(energy.time_to_max<=1|buff.berserk.up|cooldown.tigers_fury.remains<3)&buff.savage_roar.remains<12.6
actions.finisher+=/ferocious_bite,max_energy=1,if=(energy.time_to_max<=1|buff.berserk.up|cooldown.tigers_fury.remains<3)

actions.maintain=rake,cycle_targets=1,if=!talent.bloodtalons.enabled&remains<3&combo_points<5&((target.time_to_die-remains>3&active_enemies<3)|target.time_to_die-remains>6)
actions.maintain+=/rake,cycle_targets=1,if=!talent.bloodtalons.enabled&remains<4.5&combo_points<5&persistent_multiplier>dot.rake.pmultiplier&((target.time_to_die-remains>3&active_enemies<3)|target.time_to_die-remains>6)
actions.maintain+=/rake,cycle_targets=1,if=talent.bloodtalons.enabled&remains<4.5&combo_points<5&(!buff.predatory_swiftness.up|buff.bloodtalons.up|persistent_multiplier>dot.rake.pmultiplier)&((target.time_to_die-remains>3&active_enemies<3)|target.time_to_die-remains>6)
actions.maintain+=/thrash_cat,cycle_targets=1,if=talent.bloodtalons.enabled&combo_points=5&remains<4.5&buff.omen_of_clarity.react
actions.maintain+=/moonfire_cat,cycle_targets=1,if=combo_points<5&remains<4.2&active_enemies<6&target.time_to_die-remains>tick_time*5
actions.maintain+=/rake,cycle_targets=1,if=persistent_multiplier>dot.rake.pmultiplier&combo_points<5&active_enemies=1

actions.generator=swipe,if=active_enemies>=3
actions.generator+=/shred,if=active_enemies<3

head=crown_of_woe,id=118941
neck=mordant_gorget,id=119011,bonus_id=202/560,enchant=40crit
shoulders=spireflame_spaulders,id=114457,bonus_id=34/563
back=rotmelter_mosscloak,id=116294
chest=crystalbinder_chestguard,id=109886,bonus_id=42/524
shirt=undisputed_champions_shirt,id=98082
wrists=bloodfeather_bracers,id=109869,bonus_id=524
hands=bloodfeather_grips,id=109849,bonus_id=522
waist=supple_waistguard,id=116183,bonus_id=115/525/535
legs=legguards_of_burning_focus,id=109809,bonus_id=524
feet=boots_of_determined_resolve,id=114502,bonus_id=30
finger1=timeless_solium_band_of_the_assassin,id=118297,enchant=30crit
finger2=ceds_chiming_circle,id=109760,bonus_id=523/524,gems=35crit,enchant=30crit
trinket1=bloodmaws_tooth,id=116289
trinket2=grandiose_plans,id=114549
main_hand=grandiose_polearm,id=115332,bonus_id=236

# Gear Summary
# gear_agility=2135
# gear_stamina=2666
# gear_crit_rating=985
# gear_haste_rating=820
# gear_mastery_rating=335
# gear_armor=827
# gear_multistrike_rating=327
# gear_versatility_rating=333
# gear_speed_rating=95

Mekkasus

Mekkasus : 18545 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
18544.6 18544.6 8.5 / 0.046% 2702.5 / 14.6% 900.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
10.8 10.8 Focus 0.00% 51.4 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Mekkasus/advanced
Talents
  • 15: Crouching Tiger, Hidden Chimaera
  • 30: Binding Shot
  • 45: Spirit Bond
  • 60: Dire Beast
  • 75: A Murder of Crows
  • 90: Glaive Toss
  • 100: Adaptation (Beast Mastery Hunter)
  • Talent Calculator
Glyphs
  • Glyph of Animal Bond
  • Glyph of Disengage
  • Glyph of Deterrence
  • Glyph of Tame Beast
  • Glyph of Fetch
  • Glyph of Stampede
Professions
  • alchemy: 603
  • herbalism: 700

Charts

http://6.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Mekkasus+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x270&chd=t:113943|36879|31836|18637|14459|8188|2843|1847&chds=0,227885&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,69CCF0,ABD473,C79C6E&chm=t++113943++a_murder_of_crows,C79C6E,0,0,15|t++36879++dire_beast,C79C6E,1,0,15|t++31836++kill_shot,C79C6E,2,0,15|t++18637++kill_command,C79C6E,3,0,15|t++14459++glaive_toss,C79C6E,4,0,15|t++8188++arcane_shot,69CCF0,5,0,15|t++2843++cobra_shot,ABD473,6,0,15|t++1847++auto_shot,C79C6E,7,0,15& http://7.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Mekkasus+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:30,27,21,21,19,19,17,13,13,5,5&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,69CCF0,ABD473,C79C6E,C79C6E,C79C6E&chl=cat: melee|cat: kill_command|crow_peck|kill_shot|cat: claw|auto_shot|arcane_shot|cobra_shot|dire_beast_1: dire_beast_melee|glaive_2|glaive_1&
http://9.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Mekkasus+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:jmnquxz0234421zwtrnnljjhgefggggggggggggfffeeedcbbaZYYZabcefhjkllmmnoooooonmlkigfdcbbaZZYZZaaaaaaaaaaaaaaaaaaaZZYYYYabcefhjlmoopqrrsssrrqpnmljigeddcbaaabbbcccccccccccccccccccbbbcdefhijlmopqrsttuuuutsrqponmlkjiihgghhhiiijjjjjjjjjiiiiiiiiiijklnoqsuvxz024567777754210yxvutrqonmmmmllllllllkkkjjjiiiihggghijklnoqrtuvxz02334443210zyxwvutsqponnnnnnnmmllkkkjjiiihgffeeeefeedbZYWVTSQP&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.617152,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=18545|max=30049&chxp=1,1,62,100 http://2.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Mekkasus+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,2,0,1,3,4,10,17,29,38,57,93,160,215,271,371,491,642,813,944,1160,1272,1474,1579,1704,1709,1551,1548,1479,1406,1210,1050,855,695,576,435,348,239,182,112,82,65,38,33,14,7,7,3,3,2&chds=0,1709&chbh=5&chxt=x&chxl=0:|min=15595|avg=18545|max=21319&chxp=0,1,52,100& http://8.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Mekkasus+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:45.3,20.2,14.2,6.3,6.3,3.4,2.4,1.8&chds=0,100&chdls=ffffff&chco=ABD473,69CCF0,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=cobra_shot 136.4s|arcane_shot 60.7s|kill_command 42.8s|kill_shot 19.1s|glaive_toss 19.0s|dire_beast 10.3s|focus_fire 7.3s|a_murder_of_crows 5.4s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Mekkasus 18545
a_murder_of_crows 0 (2050) 0.0% (11.0%) 5.4 61.32sec 114440 113943

Stats details: a_murder_of_crows

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.38 5.38 78.63 78.63 1.0045 1.0000 0.00 0.00 0.00 7323.46 113942.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.38 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 78.6 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: a_murder_of_crows

Static Values
  • id:131894
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131894
  • name:A Murder of Crows
  • school:physical
  • tooltip:Under attack by a flock of crows.
  • description:Summons a flock of crows to attack your target over the next {$d=15 seconds}. If the target dies while under attack, A Murder of Crows' cooldown is reset.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
 
    crow_peck 2050 11.0% 0.0 0.00sec 0 0 Direct 78.6 5494 11290 7231 30.0% 21.6 1649 3386 30.0%  

Stats details: crow_peck

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 78.63 0.00 0.00 0.0000 0.0000 615404.61 945779.72 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 6.48 30.00% 3386.35 2650 4787 3382.44 0 4787 21930 33703 34.87
multistrike 15.11 70.00% 1648.65 1299 2346 1650.54 1314 2077 24913 38288 34.93
hit 55.07 70.03% 5493.72 4330 7821 5498.89 4658 6315 302522 464928 34.93
crit 23.56 29.97% 11289.94 8833 15955 11301.55 9471 13532 266040 408861 34.93
 
DPS Timeline Chart
 

Action details: crow_peck

Static Values
  • id:131900
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131900
  • name:A Murder of Crows
  • school:physical
  • tooltip:
  • description:Deals {$s1=1} physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.170000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
arcane_shot 1653 8.9% 60.4 4.91sec 8225 8188 Direct 60.2 5885 12149 7618 27.7% 16.5 1766 3643 27.8%  

Stats details: arcane_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.38 60.23 0.00 0.00 1.0045 0.0000 496652.28 496652.28 0.00 8188.42 8188.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 4.60 27.80% 3643.01 2936 5047 3604.06 0 5047 16752 16752 0.00
multistrike 11.95 72.20% 1765.53 1439 2474 1765.84 1439 2209 21090 21090 0.00
hit 43.56 72.32% 5884.54 4797 8246 5884.66 5397 6494 256307 256307 0.00
crit 16.67 27.68% 12148.55 9786 16823 12153.74 10344 14212 202504 202504 0.00
 
DPS Timeline Chart
 

Action details: arcane_shot

Static Values
  • id:3044
  • school:arcane
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.000
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.thrill_of_the_hunt.react&focus>35)|buff.bestial_wrath.up
Spelldata
  • id:3044
  • name:Arcane Shot
  • school:arcane
  • tooltip:
  • description:An instant shot that causes $sw2 Arcane damage.$?p131564[ Grants {$142978s1=122} PvP Power for {$142978d=6 seconds}.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.26
 
auto_shot 1844 9.9% 129.2 2.34sec 4292 1847 Direct 129.2 3093 6359 3965 26.7% 35.5 928 1907 26.6%  

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 129.16 129.16 0.00 0.00 2.3239 0.0000 554280.49 851841.60 34.93 1846.69 1846.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 9.45 26.62% 1907.36 1605 2767 1907.97 1605 2578 18021 27695 34.93
multistrike 26.04 73.38% 928.03 787 1356 928.15 827 1071 24167 37141 34.93
hit 94.67 73.30% 3093.09 2622 4521 3093.69 2837 3295 292836 450043 34.93
crit 34.48 26.70% 6358.83 5349 9222 6360.53 5714 7077 219256 336962 34.93
 
DPS Timeline Chart
 

Action details: auto_shot

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
cobra_shot 1289 7.0% 86.4 3.34sec 4490 2843 Direct 86.1 3261 6682 4160 26.3% 23.7 978 2004 26.2%  

Stats details: cobra_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 86.36 86.11 0.00 0.00 1.5792 0.0000 387743.17 387743.17 0.00 2843.19 2843.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 6.20 26.19% 2004.15 1762 3028 1998.99 0 2753 12423 12423 0.00
multistrike 17.47 73.81% 978.24 864 1484 978.57 864 1150 17089 17089 0.00
hit 63.48 73.72% 3261.15 2878 4948 3262.20 3022 3514 207010 207010 0.00
crit 22.63 26.28% 6681.57 5872 10094 6685.22 5978 7502 151221 151221 0.00
 
DPS Timeline Chart
 

Action details: cobra_shot

Static Values
  • id:77767
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.pre_steady_focus.up&(14+cast_regen)<=focus.deficit
Spelldata
  • id:77767
  • name:Cobra Shot
  • school:nature
  • tooltip:
  • description:Deals $sw2 Nature damage and generates {$91954s1=14} Focus. Usable while moving.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.76
 
dire_beast 0 (1269) 0.0% (6.8%) 10.3 30.71sec 37044 36879

Stats details: dire_beast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.29 10.29 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 36878.84 36878.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.29 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: dire_beast

Static Values
  • id:120679
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:120679
  • name:Dire Beast
  • school:nature
  • tooltip:
  • description:Summons a powerful wild beast to attack your target for {$d=15 seconds}. Each time the beast deals damage, you will gain {$120694s1=2} Focus.
 
    dire_beast_melee (dire_beast_1) 2673 6.8% 95.9 3.13sec 3977 2568 Direct 95.9 2882 5802 3674 27.1% 26.3 864 1741 27.1%  

Stats details: dire_beast_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.86 95.86 0.00 0.00 1.5488 0.0000 381179.72 585813.04 34.93 2567.54 2567.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 7.12 27.06% 1740.75 1459 2396 1739.58 0 2396 12393 19046 34.90
multistrike 19.19 72.94% 864.27 729 1198 864.13 748 1016 16588 25493 34.93
hit 69.84 72.86% 2881.51 2431 3993 2881.10 2620 3124 201241 309275 34.93
crit 26.02 27.14% 5801.88 4862 7986 5803.16 5076 6676 150958 231999 34.93
 
DPS Timeline Chart
 

Action details: dire_beast_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
glaive_toss 0 (915) 0.0% (4.9%) 18.9 16.14sec 14524 14459

Stats details: glaive_toss

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.94 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 14459.01 14459.01
 
DPS Timeline Chart
 

Action details: glaive_toss

Static Values
  • id:117050
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:117050
  • name:Glaive Toss
  • school:stormstrike
  • tooltip:
  • description:You hurl two glaives toward a target, each dealing {$120761s1=1} damage to each enemy struck and reducing movement speed by {$120761s2=30}% for {$120761d=3 seconds}. The primary target will take {$s1=4} times as much damage from each strike. The Glaives will return back to you, damaging and snaring targets again as they return.
 
    glaive_1 457 2.5% 0.0 0.00sec 0 0 Direct 18.7 5308 10894 6804 26.8% 5.1 1592 3270 27.0%  

Stats details: glaive_1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 18.67 0.00 0.00 0.0000 0.0000 137487.08 211295.93 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.38 26.95% 3269.99 2748 4963 2453.90 0 4963 4516 6940 26.19
multistrike 3.74 73.05% 1591.84 1347 2433 1556.61 0 2433 5958 9156 34.14
hit 13.67 73.23% 5308.32 4490 8110 5310.48 4567 6176 72567 111524 34.93
crit 5.00 26.77% 10893.88 9160 16544 10864.85 0 16544 54447 83676 34.80
 
DPS Timeline Chart
 

Action details: glaive_1

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:18.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
    glaive_2 458 2.5% 0.0 0.00sec 0 0 Direct 18.7 5307 10903 6807 26.8% 5.2 1592 3269 26.7%  

Stats details: glaive_2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 18.67 0.00 0.00 0.0000 0.0000 137595.57 211462.66 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.38 26.75% 3269.27 2748 4963 2459.03 0 4963 4509 6929 26.25
multistrike 3.78 73.25% 1592.05 1347 2433 1558.01 0 2433 6013 9241 34.16
hit 13.66 73.19% 5306.64 4490 8110 5308.74 4547 6168 72509 111435 34.93
crit 5.00 26.81% 10903.15 9160 16544 10870.75 0 16544 54566 83859 34.80
 
DPS Timeline Chart
 

Action details: glaive_2

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:18.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
kill_command 0 (2653) 0.0% (14.3%) 42.6 7.09sec 18721 18637

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.59 42.59 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 18637.25 18637.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.59 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: kill_command

Static Values
  • id:34026
  • school:physical
  • resource:focus
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:6.000
  • base_execute_time:-10.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:34026
  • name:Kill Command
  • school:physical
  • tooltip:
  • description:Give the command to kill, causing your pet to instantly inflict $<damage> damage to its target. 25 yard range.
 
    kill_command (cat) 2653 14.3% 42.6 7.09sec 18721 0 Direct 42.6 12591 25414 17293 36.7% 11.7 3778 7629 36.9%  

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.59 42.59 0.00 0.00 0.0000 0.0000 797413.55 1225498.72 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 4.32 36.89% 7629.31 6159 12138 7523.78 0 12138 32926 50602 34.43
multistrike 7.38 63.11% 3778.23 3079 6069 3777.16 0 5916 27892 42866 34.90
hit 26.97 63.33% 12590.82 10265 20230 12595.60 11097 14317 339628 521955 34.93
crit 15.62 36.67% 25413.50 20529 40460 25431.64 21334 30330 396967 610075 34.93
 
DPS Timeline Chart
 

Action details: kill_command

Static Values
  • id:83381
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:83381
  • name:Kill Command
  • school:physical
  • tooltip:
  • description:{$@spelldesc34026=Give the command to kill, causing your pet to instantly inflict $<damage> damage to its target. 25 yard range.}
 
kill_shot 2020 10.9% 19.0 5.77sec 31978 31836 Direct 18.9 23260 47736 29670 26.2% 5.2 6979 14327 26.0%  

Stats details: kill_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.99 18.90 0.00 0.00 1.0045 0.0000 607148.40 933091.22 34.93 31836.21 31836.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.36 26.01% 14326.79 11867 20397 10660.29 0 20397 19421 29848 25.99
multistrike 3.86 73.99% 6979.44 5817 9998 6843.94 0 9998 26908 41354 34.25
hit 13.95 73.81% 23259.75 19390 33328 23271.05 19749 27621 324498 498703 34.93
crit 4.95 26.19% 47736.45 39555 67989 47658.53 0 67989 236320 363187 34.81
 
DPS Timeline Chart
 

Action details: kill_shot

Static Values
  • id:53351
  • school:physical
  • resource:none
  • range:45.0
  • travel_speed:80.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.000
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:focus.time_to_max>gcd
Spelldata
  • id:53351
  • name:Kill Shot
  • school:physical
  • tooltip:
  • description:You attempt to finish off a wounded target, dealing $sw2 Physical damage. Only usable on enemies with less than 20% health. If the target dies, the Hunter will regain {$164851s1=15}% of maximum health. If Kill Shot fails to kill the target, the cooldown is reset.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:7.86
 
pet - cat 7504 / 7504
claw 1881 10.1% 98.7 3.07sec 5724 5699 Direct 98.7 3614 7391 5288 44.3% 27.1 1085 2216 44.4%  

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.68 98.68 0.00 0.00 1.0045 0.0000 564898.01 868159.05 34.93 5698.62 5698.62
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 12.04 44.41% 2216.25 1384 5454 2217.46 1395 4431 26682 41006 34.93
multistrike 15.07 55.59% 1085.07 692 2727 1085.50 692 1928 16351 25129 34.93
hit 54.94 55.67% 3613.88 2306 9090 3615.38 2801 4711 198541 305126 34.93
crit 43.75 44.33% 7390.84 4612 18180 7396.21 5562 9671 323324 496898 34.93
 
DPS Timeline Chart
 

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, causing ${$<damage>} damage. Deals {$62762s2=100}% more damage and costs {$62762s1=100}% more Focus when your pet has 50 or more Focus.
 
kill_command 2653 14.3% 42.6 7.09sec 18721 0 Direct 42.6 12591 25414 17293 36.7% 11.7 3778 7629 36.9%  

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.59 42.59 0.00 0.00 0.0000 0.0000 797413.55 1225498.72 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 4.32 36.89% 7629.31 6159 12138 7523.78 0 12138 32926 50602 34.43
multistrike 7.38 63.11% 3778.23 3079 6069 3777.16 0 5916 27892 42866 34.90
hit 26.97 63.33% 12590.82 10265 20230 12595.60 11097 14317 339628 521955 34.93
crit 15.62 36.67% 25413.50 20529 40460 25431.64 21334 30330 396967 610075 34.93
 
DPS Timeline Chart
 

Action details: kill_command

Static Values
  • id:83381
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:83381
  • name:Kill Command
  • school:physical
  • tooltip:
  • description:{$@spelldesc34026=Give the command to kill, causing your pet to instantly inflict $<damage> damage to its target. 25 yard range.}
 
melee 2970 16.0% 228.8 1.31sec 3902 2974 Direct 228.8 2624 5295 3606 36.7% 62.8 787 1588 36.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 228.81 228.81 0.00 0.00 1.3123 0.0000 892829.54 1372138.03 34.93 2973.54 2973.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 23.03 36.70% 1588.46 1294 2550 1588.92 1388 1890 36587 56229 34.93
multistrike 39.73 63.30% 787.19 647 1275 787.30 692 890 31271 48059 34.93
hit 144.75 63.26% 2624.44 2156 4250 2624.76 2422 2815 379876 583810 34.93
crit 84.06 36.74% 5294.80 4313 8500 5296.73 4720 5795 445095 684040 34.93
 
DPS Timeline Chart
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - dire_beast_1 2673 / 1269
dire_beast_melee 2673 6.8% 95.9 3.13sec 3977 2568 Direct 95.9 2882 5802 3674 27.1% 26.3 864 1741 27.1%  

Stats details: dire_beast_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.86 95.86 0.00 0.00 1.5488 0.0000 381179.72 585813.04 34.93 2567.54 2567.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 7.12 27.06% 1740.75 1459 2396 1739.58 0 2396 12393 19046 34.90
multistrike 19.19 72.94% 864.27 729 1198 864.13 748 1016 16588 25493 34.93
hit 69.84 72.86% 2881.51 2431 3993 2881.10 2620 3124 201241 309275 34.93
crit 26.02 27.14% 5801.88 4862 7986 5803.16 5076 6676 150958 231999 34.93
 
DPS Timeline Chart
 

Action details: dire_beast_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Simple Action Stats Execute Interval
Mekkasus
bestial_wrath 5.3 62.75sec

Stats details: bestial_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.26 5.26 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.26 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: bestial_wrath

Static Values
  • id:19574
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:focus>60&!buff.bestial_wrath.up
Spelldata
  • id:19574
  • name:Bestial Wrath
  • school:physical
  • tooltip:Damage dealt increased by {$?s3044=true}[{$s7=10}%][{$s2=20}%].
  • description:Sends you and your pet into a rage for {$d=10 seconds}. Your pet deals {$s2=20}% additional damage and breaks all loss of control effects. You deal {$s7=10}% more damage and your shots cost {$s6=50}% less Focus.{$?s119410=false}[ Your pet cannot be killed while this effect is active.][ ]
 
draenic_agility_potion 2.0 0.00sec

Stats details: draenic_agility_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156423
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156423
  • name:Draenic Agility Potion
  • school:physical
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
 
focus_fire 7.3 38.72sec

Stats details: focus_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.25 7.25 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.25 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: focus_fire

Static Values
  • id:82692
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:82692
  • name:Focus Fire
  • school:physical
  • tooltip:Haste increased by $w1%.
  • description:Your pet's Basic Attacks have a {$19623s2=40}% chance to trigger Frenzy, granting {$19623s1=4}% increased attack speed for {$19615d=30 seconds}, stacking up to {$19615u=5} times. Focus Fire consumes all your pet's Frenzy, restoring {$s2=6} Focus to your pet and increasing your haste by {$s1=6}% per Frenzy application consumed. Lasts for {$d=20 seconds}.
 
summon_pet 1.0 0.00sec

Stats details: summon_pet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: summon_pet

Static Values
  • id:0
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
bestial_wrath 5.3 0.0 62.8sec 62.8sec 17.24% 41.41% 0.0(0.0)

Buff details

  • buff initial source:Mekkasus
  • cooldown name:buff_bestial_wrath
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bestial_wrath_1:17.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:19574
  • name:Bestial Wrath
  • tooltip:Damage dealt increased by {$?s3044=true}[{$s7=10}%][{$s2=20}%].
  • description:Sends you and your pet into a rage for {$d=10 seconds}. Your pet deals {$s2=20}% additional damage and breaks all loss of control effects. You deal {$s7=10}% more damage and your shots cost {$s6=50}% less Focus.{$?s119410=false}[ Your pet cannot be killed while this effect is active.][ ]
  • max_stacks:0
  • duration:10.00
  • cooldown:60.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 12.24% 0.0(0.0)

Buff details

  • buff initial source:Mekkasus
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
cobra_strikes 11.1 0.9 25.4sec 23.3sec 7.06% 12.15% 0.0(0.0)

Buff details

  • buff initial source:Mekkasus
  • cooldown name:buff_cobra_strikes
  • max_stacks:6
  • duration:15.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:0.00

Stack Uptimes

  • cobra_strikes_1:6.66%
  • cobra_strikes_2:0.39%
  • cobra_strikes_3:0.02%
  • cobra_strikes_4:0.00%
  • cobra_strikes_5:0.00%

Trigger Attempt Success

  • trigger_pct:20.00%

Spelldata details

  • id:53257
  • name:Cobra Strikes
  • tooltip:Pet's critical strike chance with Basic Attacks increased by 100%.
  • description:{$@spelldesc53260=Your successful Arcane Shots have a {$h=20}% chance to grant you a charge of Cobra Strikes. Each charge causes 1 of your pet's Basic Attacks to critically hit. Max 6 charges.}
  • max_stacks:6
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
draenic_agility_potion 2.0 0.0 260.7sec 0.0sec 15.00% 15.02% 0.0(0.0)

Buff details

  • buff initial source:Mekkasus
  • cooldown name:buff_draenic_agility_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:1000.00

Stack Uptimes

  • draenic_agility_potion_1:15.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156423
  • name:Draenic Agility Potion
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
focus_fire 6.8 0.5 41.8sec 38.7sec 46.05% 49.07% 0.5(0.5)

Buff details

  • buff initial source:Mekkasus
  • cooldown name:buff_focus_fire
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • focus_fire_1:46.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:82692
  • name:Focus Fire
  • tooltip:Haste increased by $w1%.
  • description:Your pet's Basic Attacks have a {$19623s2=40}% chance to trigger Frenzy, granting {$19623s1=4}% increased attack speed for {$19615d=30 seconds}, stacking up to {$19615u=5} times. Focus Fire consumes all your pet's Frenzy, restoring {$s2=6} Focus to your pet and increasing your haste by {$s1=6}% per Frenzy application consumed. Lasts for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
lord_blastingtons_scope_of_doom 9.7 7.0 30.4sec 17.1sec 42.23% 42.24% 7.0(7.0)

Buff details

  • buff initial source:Mekkasus
  • cooldown name:buff_lord_blastingtons_scope_of_doom
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:112.00

Stack Uptimes

  • lord_blastingtons_scope_of_doom_1:42.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109085
  • name:Lord Blastington's Scope of Doom
  • tooltip:Agility increased by {$s1=112}.
  • description:Increases agility by {$s1=112}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
spirit_of_the_warlords 3.0 0.0 119.8sec 119.8sec 19.18% 19.20% 0.0(0.0)

Buff details

  • buff initial source:Mekkasus
  • cooldown name:buff_spirit_of_the_warlords
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:crit_rating
  • amount:1396.00

Stack Uptimes

  • spirit_of_the_warlords_1:19.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162915
  • name:Spirit of the Warlords
  • tooltip:Critical strike increased by {$s1=1044}.
  • description:Critical strike increased by {$s1=1044} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
(cat-) cat-bestial_wrath 5.3 0.0 62.8sec 62.8sec 17.24% 17.78% 0.0(0.0)

Buff details

  • buff initial source:Mekkasus_cat
  • cooldown name:buff_bestial_wrath
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bestial_wrath_1:17.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:19574
  • name:Bestial Wrath
  • tooltip:Damage dealt increased by {$?s3044=false}[{$s7=10}%][{$s2=20}%].
  • description:Sends you and your pet into a rage for {$d=10 seconds}. Your pet deals {$s2=20}% additional damage and breaks all loss of control effects. You deal {$s7=10}% more damage and your shots cost {$s6=50}% less Focus.{$?s119410=false}[ Your pet cannot be killed while this effect is active.][ ]
  • max_stacks:0
  • duration:10.00
  • cooldown:60.00
  • default_chance:0.00%
(cat-) cat-enhanced_basic_attacks 14.8 0.0 19.0sec 19.0sec 10.43% 14.82% 0.0(0.0)

Buff details

  • buff initial source:Mekkasus_cat
  • cooldown name:buff_enhanced_basic_attacks
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • enhanced_basic_attacks_1:10.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:157715
  • name:Enhanced Basic Attacks
  • tooltip:
  • description:Your pet's basic attacks have a {$s1=15}% chance to reset the basic attack cooldown and make the next basic attack free.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
(cat-) cat-frenzy 8.5 31.0 36.9sec 7.6sec 82.75% 82.67% 0.0(0.0)

Buff details

  • buff initial source:Mekkasus_cat
  • cooldown name:buff_frenzy
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:40.00%
  • default_value:0.00

Stack Uptimes

  • frenzy_1:20.33%
  • frenzy_2:20.31%
  • frenzy_3:20.30%
  • frenzy_4:20.00%
  • frenzy_5:1.81%

Trigger Attempt Success

  • trigger_pct:39.93%

Spelldata details

  • id:19615
  • name:Frenzy
  • tooltip:$?$w1>0[Attack speed increased by $w1%.][Pet attack speed increased by {$s1=4}%]
  • description:The Hunter's pet gains attack speed after performing a Basic Attack, lasting for {$19615d=30 seconds} and stacking up to {$19615u=5} times.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_agility_flask

Buff details

  • buff initial source:Mekkasus
  • cooldown name:buff_greater_draenic_agility_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:250.00

Stack Uptimes

  • greater_draenic_agility_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156064
  • name:Greater Draenic Agility Flask
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Mekkasus
a_murder_of_crows Focus 5.4 108.7 20.2 20.2 5661.9
arcane_shot Focus 60.4 1389.8 23.0 23.0 357.4
glaive_toss Focus 18.9 251.9 13.3 13.3 1092.1
kill_command Focus 42.6 1511.1 35.5 35.5 527.7
pet - cat
claw Focus 84.0 2758.9 32.9 28.0 204.8
Resource Gains Type Count Total Average Overflow
focus_regen Focus 255.82 1525.88 (47.57%) 5.96 16.85 1.09%
external_healing Health 48.08 0.00 (0.00%) 0.00 325639.41 100.00%
invigoration Focus 14.83 291.34 (9.08%) 19.65 5.19 1.75%
cobra_shot Focus 86.11 1201.04 (37.44%) 13.95 4.50 0.37%
dire_beast Focus 95.86 189.25 (5.90%) 1.97 2.47 1.29%
pet - cat
focus_regen Focus 300.37 1928.26 (72.41%) 6.42 0.48 0.02%
focus_fire Focus 7.25 217.61 (8.17%) 30.00 0.00 0.00%
go_for_the_throat Focus 34.48 517.10 (19.42%) 15.00 0.10 0.02%
Resource RPS-Gain RPS-Loss
Focus 10.66 10.84
Combat End Resource Mean Min Max
Focus 46.28 0.07 100.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Focus Cap 0.5%
cat-Focus Cap 0.5%
devilsaur-Focus Cap 0.5%
raptor-Focus Cap 0.5%
hyena-Focus Cap 0.5%
wolf-Focus Cap 0.5%
wasp-Focus Cap 0.5%
t17_pet_2-Focus Cap 0.5%
t17_pet_1-Focus Cap 0.5%
dire_beast_1-Focus Cap 0.5%
dire_beast_2-Focus Cap 0.5%
tier15_thunderhawk-Focus Cap 0.5%
tier15_thunderhawk-Focus Cap 0.5%
tier15_thunderhawk-Focus Cap 0.5%
tier15_thunderhawk-Focus Cap 0.5%
tier15_thunderhawk-Focus Cap 0.5%
tier15_thunderhawk-Focus Cap 0.5%
tier15_thunderhawk-Focus Cap 0.5%
tier15_thunderhawk-Focus Cap 0.5%
tier15_thunderhawk-Focus Cap 0.5%
tier15_thunderhawk-Focus Cap 0.5%

Procs

Count Interval
starved: a_murder_of_crows 0.2 14.5sec
invigoration 14.8 19.2sec

Statistics & Data Analysis

Fight Length
Sample Data Mekkasus Fight Length
Count 25000
Mean 300.94
Minimum 230.43
Maximum 374.11
Spread ( max - min ) 143.68
Range [ ( max - min ) / 2 * 100% ] 23.87%
DPS
Sample Data Mekkasus Damage Per Second
Count 25000
Mean 18544.61
Minimum 15595.05
Maximum 21319.34
Spread ( max - min ) 5724.29
Range [ ( max - min ) / 2 * 100% ] 15.43%
Standard Deviation 687.5381
5th Percentile 17420.42
95th Percentile 19682.30
( 95th Percentile - 5th Percentile ) 2261.88
Mean Distribution
Standard Deviation 4.3484
95.00% Confidence Intervall ( 18536.08 - 18553.13 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 52
0.1% Error 5280
0.1 Scale Factor Error with Delta=300 4035
0.05 Scale Factor Error with Delta=300 16141
0.01 Scale Factor Error with Delta=300 403531
Distribution Chart
DPS(e)
Sample Data Mekkasus Damage Per Second (Effective)
Count 25000
Mean 18544.61
Minimum 15595.05
Maximum 21319.34
Spread ( max - min ) 5724.29
Range [ ( max - min ) / 2 * 100% ] 15.43%
Damage
Sample Data Mekkasus Damage
Count 25000
Mean 2936311.60
Minimum 2079439.36
Maximum 3797912.44
Spread ( max - min ) 1718473.09
Range [ ( max - min ) / 2 * 100% ] 29.26%
DTPS
Sample Data Mekkasus Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Mekkasus Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Mekkasus Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Mekkasus Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Mekkasus Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Mekkasus Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data MekkasusTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Mekkasus Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_agility_flask
1 0.00 food,type=blackrock_barbecue
2 0.00 summon_pet
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 exotic_munitions,ammo_type=poisoned,if=active_enemies<3
5 0.00 exotic_munitions,ammo_type=incendiary,if=active_enemies>=3
6 0.00 potion,name=draenic_agility
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 auto_shot
8 0.00 arcane_torrent,if=focus.deficit>=30
9 0.00 blood_fury
A 0.00 berserking
B 0.74 potion,name=draenic_agility,if=!talent.stampede.enabled&buff.bestial_wrath.up&target.health.pct<=20|target.time_to_die<=20
C 0.26 potion,name=draenic_agility,if=talent.stampede.enabled&cooldown.stampede.remains<1&(buff.bloodlust.up|buff.focus_fire.up)|target.time_to_die<=25
D 0.00 stampede,if=buff.bloodlust.up|buff.focus_fire.up|target.time_to_die<=25
E 10.29 dire_beast
F 0.00 explosive_trap,if=active_enemies>1
G 5.26 bestial_wrath,if=focus>60&!buff.bestial_wrath.up
H 0.00 barrage,if=active_enemies>1
I 0.00 multishot,if=active_enemies>5|(active_enemies>1&pet.cat.buff.beast_cleave.down)
J 7.25 focus_fire,five_stacks=1
K 0.00 barrage,if=active_enemies>1
L 5.38 a_murder_of_crows
M 18.99 kill_shot,if=focus.time_to_max>gcd
N 42.59 kill_command
O 0.00 focusing_shot,if=focus<50
P 0.00 cobra_shot,if=buff.pre_steady_focus.up&(14+cast_regen)<=focus.deficit
Cast a second shot for steady focus if that won't cap us.
Q 18.94 glaive_toss
R 0.00 barrage
S 0.00 powershot,if=focus.time_to_max>cast_time
T 0.00 cobra_shot,if=active_enemies>5
U 28.11 arcane_shot,if=(buff.thrill_of_the_hunt.react&focus>35)|buff.bestial_wrath.up
V 32.27 arcane_shot,if=focus>=64
W 86.73 cobra_shot

Sample Sequence

01267EGLNQUUUUNUUWWWNWWQVVNWWWVNWEVWQNWWJVVNWWWVNQWWWNWWVVWEGLNQUUUWNUWWWNVQWWNWVWWEJNQWVWVNWWWVNWWQVWNWJWVNWEGLUQNUUUUWNWWWVNQWWWNWWVEJNQWVVWNWWVWNWWQVWNWWVWNELWQWMGMNUUUUUJNUMMQWWNWWWMNEMVWQNWWVMMNWWVVNWMMQWJNWELWMMNWWGBQUUNUUMMUNWWWNQMMWENWWVVMMNQWWWN

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 100.0/100: 100% focus
Pre food Fluffy_Pillow 100.0/100: 100% focus
Pre summon_pet Fluffy_Pillow 100.0/100: 100% focus
Pre potion Fluffy_Pillow 100.0/100: 100% focus draenic_agility_potion
0:00.000 start_auto_shot Fluffy_Pillow 100.0/100: 100% focus draenic_agility_potion
0:00.000 dire_beast Fluffy_Pillow 100.0/100: 100% focus draenic_agility_potion
0:01.005 bestial_wrath Fluffy_Pillow 100.0/100: 100% focus bloodlust, draenic_agility_potion
0:01.005 a_murder_of_crows Fluffy_Pillow 100.0/100: 100% focus bloodlust, bestial_wrath, draenic_agility_potion
0:02.010 kill_command Fluffy_Pillow 92.7/100: 93% focus bloodlust, bestial_wrath, draenic_agility_potion
0:03.014 glaive_toss Fluffy_Pillow 78.4/100: 78% focus bloodlust, bestial_wrath, spirit_of_the_warlords, draenic_agility_potion
0:04.019 arcane_shot Fluffy_Pillow 78.5/100: 79% focus bloodlust, bestial_wrath, spirit_of_the_warlords, draenic_agility_potion
0:05.025 arcane_shot Fluffy_Pillow 71.2/100: 71% focus bloodlust, bestial_wrath, spirit_of_the_warlords, draenic_agility_potion
0:06.029 arcane_shot Fluffy_Pillow 61.9/100: 62% focus bloodlust, bestial_wrath, spirit_of_the_warlords, draenic_agility_potion
0:07.035 arcane_shot Fluffy_Pillow 54.6/100: 55% focus bloodlust, bestial_wrath, cobra_strikes, spirit_of_the_warlords, draenic_agility_potion
0:08.039 kill_command Fluffy_Pillow 47.3/100: 47% focus bloodlust, bestial_wrath, cobra_strikes, spirit_of_the_warlords, draenic_agility_potion
0:09.045 arcane_shot Fluffy_Pillow 34.9/100: 35% focus bloodlust, bestial_wrath, cobra_strikes, spirit_of_the_warlords, draenic_agility_potion
0:10.049 arcane_shot Fluffy_Pillow 25.6/100: 26% focus bloodlust, bestial_wrath, spirit_of_the_warlords, draenic_agility_potion
0:11.053 cobra_shot Fluffy_Pillow 18.3/100: 18% focus bloodlust, spirit_of_the_warlords, draenic_agility_potion
0:12.473 cobra_shot Fluffy_Pillow 28.3/100: 28% focus bloodlust, spirit_of_the_warlords, draenic_agility_potion
0:13.891 cobra_shot Fluffy_Pillow 50.3/100: 50% focus bloodlust, spirit_of_the_warlords, draenic_agility_potion
0:15.311 kill_command Fluffy_Pillow 72.4/100: 72% focus bloodlust, spirit_of_the_warlords, draenic_agility_potion
0:16.316 cobra_shot Fluffy_Pillow 52.0/100: 52% focus bloodlust, spirit_of_the_warlords, draenic_agility_potion
0:17.736 cobra_shot Fluffy_Pillow 60.1/100: 60% focus bloodlust, spirit_of_the_warlords, draenic_agility_potion
0:19.156 glaive_toss Fluffy_Pillow 82.1/100: 82% focus bloodlust, spirit_of_the_warlords, draenic_agility_potion
0:20.160 arcane_shot Fluffy_Pillow 100.0/100: 100% focus bloodlust, spirit_of_the_warlords
0:21.165 arcane_shot Fluffy_Pillow 75.7/100: 76% focus bloodlust, cobra_strikes, spirit_of_the_warlords
0:22.171 kill_command Fluffy_Pillow 51.4/100: 51% focus bloodlust, cobra_strikes, spirit_of_the_warlords, lord_blastingtons_scope_of_doom
0:23.175 cobra_shot Fluffy_Pillow 17.0/100: 17% focus bloodlust, lord_blastingtons_scope_of_doom
0:24.594 cobra_shot Fluffy_Pillow 25.1/100: 25% focus bloodlust, lord_blastingtons_scope_of_doom
0:26.013 cobra_shot Fluffy_Pillow 47.1/100: 47% focus bloodlust, lord_blastingtons_scope_of_doom
0:27.434 arcane_shot Fluffy_Pillow 69.1/100: 69% focus bloodlust, lord_blastingtons_scope_of_doom
0:28.438 kill_command Fluffy_Pillow 58.8/100: 59% focus bloodlust, lord_blastingtons_scope_of_doom
0:29.441 cobra_shot Fluffy_Pillow 24.5/100: 24% focus bloodlust, lord_blastingtons_scope_of_doom
0:30.861 dire_beast Fluffy_Pillow 52.5/100: 52% focus bloodlust, lord_blastingtons_scope_of_doom
0:31.865 arcane_shot Fluffy_Pillow 74.2/100: 74% focus bloodlust, lord_blastingtons_scope_of_doom
0:32.870 cobra_shot Fluffy_Pillow 51.8/100: 52% focus bloodlust, lord_blastingtons_scope_of_doom
0:34.290 glaive_toss Fluffy_Pillow 61.9/100: 62% focus bloodlust, lord_blastingtons_scope_of_doom
0:35.293 kill_command Fluffy_Pillow 68.5/100: 69% focus bloodlust, lord_blastingtons_scope_of_doom
0:36.298 cobra_shot Fluffy_Pillow 34.2/100: 34% focus bloodlust, lord_blastingtons_scope_of_doom
0:37.718 cobra_shot Fluffy_Pillow 44.2/100: 44% focus bloodlust
0:39.135 focus_fire Fluffy_Pillow 68.3/100: 68% focus bloodlust
0:40.137 arcane_shot Fluffy_Pillow 91.6/100: 92% focus bloodlust, focus_fire
0:41.143 arcane_shot Fluffy_Pillow 69.3/100: 69% focus focus_fire
0:42.148 kill_command Fluffy_Pillow 47.0/100: 47% focus focus_fire
0:43.154 cobra_shot Fluffy_Pillow 14.7/100: 15% focus focus_fire
0:44.573 cobra_shot Fluffy_Pillow 24.7/100: 25% focus focus_fire
0:45.994 cobra_shot Fluffy_Pillow 46.7/100: 47% focus focus_fire
0:47.414 arcane_shot Fluffy_Pillow 68.7/100: 69% focus focus_fire
0:48.418 kill_command Fluffy_Pillow 58.4/100: 58% focus focus_fire
0:49.423 glaive_toss Fluffy_Pillow 24.1/100: 24% focus focus_fire
0:50.427 cobra_shot Fluffy_Pillow 14.8/100: 15% focus focus_fire
0:51.847 cobra_shot Fluffy_Pillow 22.8/100: 23% focus focus_fire
0:53.266 cobra_shot Fluffy_Pillow 44.8/100: 45% focus focus_fire
0:54.685 kill_command Fluffy_Pillow 66.8/100: 67% focus focus_fire
0:55.688 cobra_shot Fluffy_Pillow 46.5/100: 47% focus focus_fire
0:57.107 cobra_shot Fluffy_Pillow 54.5/100: 55% focus focus_fire
0:58.526 arcane_shot Fluffy_Pillow 76.6/100: 77% focus focus_fire
0:59.530 arcane_shot Fluffy_Pillow 65.7/100: 66% focus
1:00.533 cobra_shot Fluffy_Pillow 40.1/100: 40% focus
1:02.377 dire_beast Fluffy_Pillow 48.1/100: 48% focus
1:03.381 bestial_wrath Fluffy_Pillow 68.5/100: 68% focus
1:03.381 a_murder_of_crows Fluffy_Pillow 68.5/100: 68% focus bestial_wrath
1:04.385 kill_command Fluffy_Pillow 59.8/100: 60% focus bestial_wrath
1:05.387 glaive_toss Fluffy_Pillow 44.2/100: 44% focus bestial_wrath
1:06.391 arcane_shot Fluffy_Pillow 43.0/100: 43% focus bestial_wrath
1:07.396 arcane_shot Fluffy_Pillow 32.4/100: 32% focus bestial_wrath, lord_blastingtons_scope_of_doom
1:08.402 arcane_shot Fluffy_Pillow 23.8/100: 24% focus bestial_wrath, lord_blastingtons_scope_of_doom
1:09.408 cobra_shot Fluffy_Pillow 13.2/100: 13% focus bestial_wrath, cobra_strikes, lord_blastingtons_scope_of_doom
1:11.251 kill_command Fluffy_Pillow 23.2/100: 23% focus bestial_wrath, lord_blastingtons_scope_of_doom
1:12.257 arcane_shot Fluffy_Pillow 23.5/100: 24% focus bestial_wrath, lord_blastingtons_scope_of_doom
1:13.262 cobra_shot Fluffy_Pillow 12.9/100: 13% focus bestial_wrath, lord_blastingtons_scope_of_doom
1:15.106 cobra_shot Fluffy_Pillow 22.9/100: 23% focus lord_blastingtons_scope_of_doom
1:16.949 cobra_shot Fluffy_Pillow 44.9/100: 45% focus lord_blastingtons_scope_of_doom
1:18.791 kill_command Fluffy_Pillow 67.0/100: 67% focus lord_blastingtons_scope_of_doom
1:19.797 arcane_shot Fluffy_Pillow 65.3/100: 65% focus lord_blastingtons_scope_of_doom
1:20.803 glaive_toss Fluffy_Pillow 39.7/100: 40% focus lord_blastingtons_scope_of_doom
1:21.806 cobra_shot Fluffy_Pillow 29.1/100: 29% focus lord_blastingtons_scope_of_doom
1:23.650 cobra_shot Fluffy_Pillow 37.1/100: 37% focus lord_blastingtons_scope_of_doom
1:25.493 kill_command Fluffy_Pillow 59.1/100: 59% focus
1:26.497 cobra_shot Fluffy_Pillow 37.5/100: 37% focus
1:28.340 arcane_shot Fluffy_Pillow 65.5/100: 65% focus
1:29.344 cobra_shot Fluffy_Pillow 53.8/100: 54% focus
1:31.189 cobra_shot Fluffy_Pillow 61.9/100: 62% focus
1:33.032 dire_beast Fluffy_Pillow 83.9/100: 84% focus
1:34.037 focus_fire Fluffy_Pillow 100.0/100: 100% focus
1:35.043 kill_command Fluffy_Pillow 100.0/100: 100% focus focus_fire
1:36.047 glaive_toss Fluffy_Pillow 65.7/100: 66% focus focus_fire
1:37.053 cobra_shot Fluffy_Pillow 58.4/100: 58% focus focus_fire
1:38.472 arcane_shot Fluffy_Pillow 68.4/100: 68% focus focus_fire
1:39.476 cobra_shot Fluffy_Pillow 60.1/100: 60% focus focus_fire
1:40.896 arcane_shot Fluffy_Pillow 70.1/100: 70% focus focus_fire
1:41.900 kill_command Fluffy_Pillow 59.8/100: 60% focus focus_fire
1:42.905 cobra_shot Fluffy_Pillow 27.4/100: 27% focus focus_fire
1:44.325 cobra_shot Fluffy_Pillow 37.5/100: 37% focus focus_fire
1:45.746 cobra_shot Fluffy_Pillow 61.5/100: 61% focus focus_fire
1:47.166 arcane_shot Fluffy_Pillow 83.5/100: 84% focus focus_fire
1:48.170 kill_command Fluffy_Pillow 73.2/100: 73% focus focus_fire
1:49.176 cobra_shot Fluffy_Pillow 38.9/100: 39% focus focus_fire
1:50.598 cobra_shot Fluffy_Pillow 46.9/100: 47% focus focus_fire
1:52.018 glaive_toss Fluffy_Pillow 68.9/100: 69% focus focus_fire
1:53.024 arcane_shot Fluffy_Pillow 73.6/100: 74% focus focus_fire
1:54.029 cobra_shot Fluffy_Pillow 49.3/100: 49% focus cobra_strikes, focus_fire
1:55.448 kill_command Fluffy_Pillow 55.5/100: 55% focus cobra_strikes
1:56.451 cobra_shot Fluffy_Pillow 33.9/100: 34% focus cobra_strikes
1:58.293 focus_fire Fluffy_Pillow 41.9/100: 42% focus
1:59.298 cobra_shot Fluffy_Pillow 61.5/100: 62% focus focus_fire
2:00.716 arcane_shot Fluffy_Pillow 89.6/100: 90% focus focus_fire
2:01.720 kill_command Fluffy_Pillow 79.2/100: 79% focus focus_fire
2:02.725 cobra_shot Fluffy_Pillow 44.9/100: 45% focus focus_fire
2:04.146 dire_beast Fluffy_Pillow 52.9/100: 53% focus focus_fire
2:05.152 bestial_wrath Fluffy_Pillow 74.6/100: 75% focus focus_fire
2:05.152 a_murder_of_crows Fluffy_Pillow 74.6/100: 75% focus bestial_wrath, focus_fire
2:06.155 arcane_shot Fluffy_Pillow 67.3/100: 67% focus bestial_wrath, focus_fire
2:07.160 glaive_toss Fluffy_Pillow 60.0/100: 60% focus bestial_wrath, cobra_strikes, focus_fire
2:08.166 kill_command Fluffy_Pillow 58.2/100: 58% focus bestial_wrath, cobra_strikes, focus_fire
2:09.171 arcane_shot Fluffy_Pillow 45.8/100: 46% focus bestial_wrath, focus_fire, spirit_of_the_warlords
2:10.175 arcane_shot Fluffy_Pillow 38.5/100: 39% focus bestial_wrath, focus_fire, spirit_of_the_warlords
2:11.181 arcane_shot Fluffy_Pillow 29.2/100: 29% focus bestial_wrath, focus_fire, spirit_of_the_warlords
2:12.186 arcane_shot Fluffy_Pillow 21.9/100: 22% focus bestial_wrath, focus_fire, spirit_of_the_warlords
2:13.189 cobra_shot Fluffy_Pillow 14.6/100: 15% focus bestial_wrath, cobra_strikes, focus_fire, spirit_of_the_warlords, lord_blastingtons_scope_of_doom
2:14.608 kill_command Fluffy_Pillow 24.6/100: 25% focus bestial_wrath, cobra_strikes, focus_fire, spirit_of_the_warlords, lord_blastingtons_scope_of_doom
2:15.612 cobra_shot Fluffy_Pillow 26.3/100: 26% focus focus_fire, spirit_of_the_warlords, lord_blastingtons_scope_of_doom
2:17.032 cobra_shot Fluffy_Pillow 36.3/100: 36% focus focus_fire, spirit_of_the_warlords, lord_blastingtons_scope_of_doom
2:18.450 cobra_shot Fluffy_Pillow 58.1/100: 58% focus spirit_of_the_warlords, lord_blastingtons_scope_of_doom
2:20.293 arcane_shot Fluffy_Pillow 80.1/100: 80% focus spirit_of_the_warlords, lord_blastingtons_scope_of_doom
2:21.296 kill_command Fluffy_Pillow 68.5/100: 68% focus spirit_of_the_warlords, lord_blastingtons_scope_of_doom
2:22.300 glaive_toss Fluffy_Pillow 32.8/100: 33% focus spirit_of_the_warlords
2:23.303 cobra_shot Fluffy_Pillow 22.2/100: 22% focus spirit_of_the_warlords
2:25.147 cobra_shot Fluffy_Pillow 30.2/100: 30% focus spirit_of_the_warlords
2:26.989 cobra_shot Fluffy_Pillow 52.2/100: 52% focus spirit_of_the_warlords
2:28.834 kill_command Fluffy_Pillow 74.2/100: 74% focus spirit_of_the_warlords
2:29.840 cobra_shot Fluffy_Pillow 52.6/100: 53% focus
2:31.684 cobra_shot Fluffy_Pillow 60.6/100: 61% focus
2:33.527 arcane_shot Fluffy_Pillow 82.6/100: 83% focus
2:34.530 dire_beast Fluffy_Pillow 71.0/100: 71% focus
2:35.535 focus_fire Fluffy_Pillow 77.4/100: 77% focus
2:36.540 kill_command Fluffy_Pillow 85.1/100: 85% focus focus_fire
2:37.546 glaive_toss Fluffy_Pillow 50.7/100: 51% focus focus_fire
2:38.551 cobra_shot Fluffy_Pillow 63.4/100: 63% focus focus_fire
2:39.970 arcane_shot Fluffy_Pillow 73.4/100: 73% focus focus_fire
2:40.974 arcane_shot Fluffy_Pillow 65.1/100: 65% focus focus_fire
2:41.977 cobra_shot Fluffy_Pillow 40.8/100: 41% focus focus_fire
2:43.396 kill_command Fluffy_Pillow 50.8/100: 51% focus focus_fire
2:44.401 cobra_shot Fluffy_Pillow 32.5/100: 32% focus focus_fire
2:45.821 cobra_shot Fluffy_Pillow 42.5/100: 43% focus focus_fire
2:47.239 arcane_shot Fluffy_Pillow 66.5/100: 67% focus focus_fire
2:48.243 cobra_shot Fluffy_Pillow 58.2/100: 58% focus focus_fire
2:49.662 kill_command Fluffy_Pillow 68.2/100: 68% focus focus_fire
2:50.665 cobra_shot Fluffy_Pillow 47.9/100: 48% focus focus_fire
2:52.083 cobra_shot Fluffy_Pillow 55.9/100: 56% focus focus_fire
2:53.504 glaive_toss Fluffy_Pillow 77.9/100: 78% focus focus_fire
2:54.507 arcane_shot Fluffy_Pillow 82.6/100: 83% focus focus_fire
2:55.513 cobra_shot Fluffy_Pillow 58.3/100: 58% focus focus_fire
2:56.931 kill_command Fluffy_Pillow 64.5/100: 64% focus
2:57.936 cobra_shot Fluffy_Pillow 42.9/100: 43% focus
2:59.780 cobra_shot Fluffy_Pillow 50.9/100: 51% focus lord_blastingtons_scope_of_doom
3:01.622 arcane_shot Fluffy_Pillow 72.9/100: 73% focus lord_blastingtons_scope_of_doom
3:02.626 cobra_shot Fluffy_Pillow 61.2/100: 61% focus lord_blastingtons_scope_of_doom
3:04.468 kill_command Fluffy_Pillow 69.3/100: 69% focus lord_blastingtons_scope_of_doom
3:05.471 dire_beast Fluffy_Pillow 47.6/100: 48% focus lord_blastingtons_scope_of_doom
3:06.477 a_murder_of_crows Fluffy_Pillow 54.0/100: 54% focus lord_blastingtons_scope_of_doom
3:07.481 cobra_shot Fluffy_Pillow 30.4/100: 30% focus lord_blastingtons_scope_of_doom
3:09.326 glaive_toss Fluffy_Pillow 40.4/100: 40% focus lord_blastingtons_scope_of_doom
3:10.330 cobra_shot Fluffy_Pillow 43.7/100: 44% focus lord_blastingtons_scope_of_doom
3:12.173 kill_shot Fluffy_Pillow 53.8/100: 54% focus lord_blastingtons_scope_of_doom
3:13.176 bestial_wrath Fluffy_Pillow 74.1/100: 74% focus lord_blastingtons_scope_of_doom
3:13.176 kill_shot Fluffy_Pillow 74.1/100: 74% focus bestial_wrath, lord_blastingtons_scope_of_doom
3:14.180 kill_command Fluffy_Pillow 78.5/100: 78% focus bestial_wrath, lord_blastingtons_scope_of_doom
3:15.183 arcane_shot Fluffy_Pillow 84.8/100: 85% focus bestial_wrath, lord_blastingtons_scope_of_doom
3:16.188 arcane_shot Fluffy_Pillow 74.2/100: 74% focus bestial_wrath, cobra_strikes, lord_blastingtons_scope_of_doom
3:17.191 arcane_shot Fluffy_Pillow 65.6/100: 66% focus bestial_wrath, cobra_strikes, lord_blastingtons_scope_of_doom
3:18.195 arcane_shot Fluffy_Pillow 54.9/100: 55% focus bestial_wrath, cobra_strikes, lord_blastingtons_scope_of_doom
3:19.199 arcane_shot Fluffy_Pillow 44.3/100: 44% focus bestial_wrath, cobra_strikes, lord_blastingtons_scope_of_doom
3:20.205 focus_fire Fluffy_Pillow 33.7/100: 34% focus bestial_wrath, lord_blastingtons_scope_of_doom
3:21.208 kill_command Fluffy_Pillow 39.3/100: 39% focus bestial_wrath, focus_fire, lord_blastingtons_scope_of_doom
3:22.212 arcane_shot Fluffy_Pillow 25.0/100: 25% focus bestial_wrath, focus_fire, lord_blastingtons_scope_of_doom
3:23.217 kill_shot Fluffy_Pillow 15.7/100: 16% focus focus_fire, lord_blastingtons_scope_of_doom
3:24.223 kill_shot Fluffy_Pillow 21.4/100: 21% focus focus_fire, lord_blastingtons_scope_of_doom
3:25.227 glaive_toss Fluffy_Pillow 27.1/100: 27% focus focus_fire, lord_blastingtons_scope_of_doom
3:26.232 cobra_shot Fluffy_Pillow 17.7/100: 18% focus focus_fire, lord_blastingtons_scope_of_doom
3:27.650 cobra_shot Fluffy_Pillow 25.8/100: 26% focus focus_fire, lord_blastingtons_scope_of_doom
3:29.069 kill_command Fluffy_Pillow 47.8/100: 48% focus focus_fire, lord_blastingtons_scope_of_doom
3:30.075 cobra_shot Fluffy_Pillow 27.5/100: 27% focus focus_fire
3:31.494 cobra_shot Fluffy_Pillow 35.5/100: 35% focus focus_fire
3:32.913 cobra_shot Fluffy_Pillow 57.5/100: 58% focus focus_fire
3:34.332 kill_shot Fluffy_Pillow 79.5/100: 80% focus focus_fire
3:35.338 kill_command Fluffy_Pillow 99.2/100: 99% focus focus_fire
3:36.344 dire_beast Fluffy_Pillow 64.9/100: 65% focus focus_fire
3:37.348 kill_shot Fluffy_Pillow 72.6/100: 73% focus focus_fire
3:38.353 arcane_shot Fluffy_Pillow 80.3/100: 80% focus focus_fire
3:39.359 cobra_shot Fluffy_Pillow 57.9/100: 58% focus cobra_strikes, focus_fire
3:40.778 glaive_toss Fluffy_Pillow 67.2/100: 67% focus
3:41.781 kill_command Fluffy_Pillow 70.6/100: 71% focus
3:42.785 cobra_shot Fluffy_Pillow 36.9/100: 37% focus
3:44.629 cobra_shot Fluffy_Pillow 47.0/100: 47% focus
3:46.472 arcane_shot Fluffy_Pillow 71.0/100: 71% focus
3:47.477 kill_shot Fluffy_Pillow 59.3/100: 59% focus
3:48.481 kill_shot Fluffy_Pillow 65.7/100: 66% focus
3:49.485 kill_command Fluffy_Pillow 70.1/100: 70% focus
3:50.490 cobra_shot Fluffy_Pillow 36.4/100: 36% focus
3:52.332 cobra_shot Fluffy_Pillow 44.4/100: 44% focus
3:54.177 arcane_shot Fluffy_Pillow 66.5/100: 66% focus
3:55.181 arcane_shot Fluffy_Pillow 74.8/100: 75% focus
3:56.185 kill_command Fluffy_Pillow 49.2/100: 49% focus cobra_strikes
3:57.189 cobra_shot Fluffy_Pillow 13.6/100: 14% focus
3:59.031 kill_shot Fluffy_Pillow 21.6/100: 22% focus
4:00.036 kill_shot Fluffy_Pillow 39.9/100: 40% focus
4:01.042 glaive_toss Fluffy_Pillow 44.3/100: 44% focus
4:02.047 cobra_shot Fluffy_Pillow 33.7/100: 34% focus
4:03.892 focus_fire Fluffy_Pillow 41.7/100: 42% focus
4:04.897 kill_command Fluffy_Pillow 61.4/100: 61% focus focus_fire
4:05.902 cobra_shot Fluffy_Pillow 27.1/100: 27% focus focus_fire
4:07.321 dire_beast Fluffy_Pillow 35.1/100: 35% focus focus_fire, spirit_of_the_warlords
4:08.325 a_murder_of_crows Fluffy_Pillow 56.8/100: 57% focus focus_fire, spirit_of_the_warlords
4:09.329 cobra_shot Fluffy_Pillow 34.4/100: 34% focus focus_fire, spirit_of_the_warlords
4:10.748 kill_shot Fluffy_Pillow 44.5/100: 44% focus focus_fire, spirit_of_the_warlords
4:11.753 kill_shot Fluffy_Pillow 66.1/100: 66% focus focus_fire, spirit_of_the_warlords
4:12.757 kill_command Fluffy_Pillow 71.8/100: 72% focus focus_fire, spirit_of_the_warlords, lord_blastingtons_scope_of_doom
4:13.762 cobra_shot Fluffy_Pillow 39.5/100: 39% focus focus_fire, spirit_of_the_warlords, lord_blastingtons_scope_of_doom
4:15.181 cobra_shot Fluffy_Pillow 49.5/100: 50% focus focus_fire, spirit_of_the_warlords, lord_blastingtons_scope_of_doom
4:16.602 bestial_wrath Fluffy_Pillow 73.5/100: 74% focus focus_fire, spirit_of_the_warlords, lord_blastingtons_scope_of_doom
4:16.602 potion Fluffy_Pillow 73.5/100: 74% focus bestial_wrath, focus_fire, spirit_of_the_warlords, lord_blastingtons_scope_of_doom
4:16.602 glaive_toss Fluffy_Pillow 73.5/100: 74% focus bestial_wrath, focus_fire, spirit_of_the_warlords, lord_blastingtons_scope_of_doom, draenic_agility_potion
4:17.606 arcane_shot Fluffy_Pillow 87.7/100: 88% focus bestial_wrath, focus_fire, spirit_of_the_warlords, lord_blastingtons_scope_of_doom, draenic_agility_potion
4:18.610 arcane_shot Fluffy_Pillow 78.4/100: 78% focus bestial_wrath, focus_fire, spirit_of_the_warlords, lord_blastingtons_scope_of_doom, draenic_agility_potion
4:19.616 kill_command Fluffy_Pillow 71.1/100: 71% focus bestial_wrath, focus_fire, spirit_of_the_warlords, lord_blastingtons_scope_of_doom, draenic_agility_potion
4:20.620 arcane_shot Fluffy_Pillow 58.8/100: 59% focus bestial_wrath, focus_fire, spirit_of_the_warlords, lord_blastingtons_scope_of_doom, draenic_agility_potion
4:21.624 arcane_shot Fluffy_Pillow 49.4/100: 49% focus bestial_wrath, focus_fire, spirit_of_the_warlords, lord_blastingtons_scope_of_doom, draenic_agility_potion
4:22.628 kill_shot Fluffy_Pillow 40.1/100: 40% focus bestial_wrath, focus_fire, spirit_of_the_warlords, lord_blastingtons_scope_of_doom, draenic_agility_potion
4:23.632 kill_shot Fluffy_Pillow 45.8/100: 46% focus bestial_wrath, focus_fire, spirit_of_the_warlords, lord_blastingtons_scope_of_doom, draenic_agility_potion
4:24.636 arcane_shot Fluffy_Pillow 50.5/100: 50% focus bestial_wrath, spirit_of_the_warlords, lord_blastingtons_scope_of_doom, draenic_agility_potion
4:25.642 kill_command Fluffy_Pillow 39.9/100: 40% focus bestial_wrath, spirit_of_the_warlords, lord_blastingtons_scope_of_doom, draenic_agility_potion
4:26.646 cobra_shot Fluffy_Pillow 24.2/100: 24% focus spirit_of_the_warlords, lord_blastingtons_scope_of_doom, draenic_agility_potion
4:28.489 cobra_shot Fluffy_Pillow 32.2/100: 32% focus lord_blastingtons_scope_of_doom, draenic_agility_potion
4:30.333 cobra_shot Fluffy_Pillow 54.3/100: 54% focus lord_blastingtons_scope_of_doom, draenic_agility_potion
4:32.177 kill_command Fluffy_Pillow 76.3/100: 76% focus lord_blastingtons_scope_of_doom, draenic_agility_potion
4:33.181 glaive_toss Fluffy_Pillow 54.6/100: 55% focus lord_blastingtons_scope_of_doom, draenic_agility_potion
4:34.185 kill_shot Fluffy_Pillow 44.0/100: 44% focus lord_blastingtons_scope_of_doom, draenic_agility_potion
4:35.190 kill_shot Fluffy_Pillow 48.4/100: 48% focus lord_blastingtons_scope_of_doom, draenic_agility_potion
4:36.195 cobra_shot Fluffy_Pillow 52.7/100: 53% focus lord_blastingtons_scope_of_doom, draenic_agility_potion
4:38.039 dire_beast Fluffy_Pillow 60.8/100: 61% focus lord_blastingtons_scope_of_doom, draenic_agility_potion
4:39.043 kill_command Fluffy_Pillow 81.1/100: 81% focus lord_blastingtons_scope_of_doom, draenic_agility_potion
4:40.047 cobra_shot Fluffy_Pillow 47.5/100: 47% focus lord_blastingtons_scope_of_doom, draenic_agility_potion
4:41.891 cobra_shot Fluffy_Pillow 57.5/100: 58% focus lord_blastingtons_scope_of_doom
4:43.735 arcane_shot Fluffy_Pillow 81.5/100: 82% focus lord_blastingtons_scope_of_doom
4:44.739 arcane_shot Fluffy_Pillow 69.9/100: 70% focus lord_blastingtons_scope_of_doom
4:45.744 kill_shot Fluffy_Pillow 46.3/100: 46% focus lord_blastingtons_scope_of_doom
4:46.747 kill_shot Fluffy_Pillow 50.6/100: 51% focus lord_blastingtons_scope_of_doom
4:47.750 kill_command Fluffy_Pillow 57.0/100: 57% focus lord_blastingtons_scope_of_doom
4:48.754 glaive_toss Fluffy_Pillow 21.3/100: 21% focus lord_blastingtons_scope_of_doom
4:49.758 cobra_shot Fluffy_Pillow 12.7/100: 13% focus lord_blastingtons_scope_of_doom
4:51.599 cobra_shot Fluffy_Pillow 20.7/100: 21% focus lord_blastingtons_scope_of_doom
4:53.441 cobra_shot Fluffy_Pillow 42.7/100: 43% focus
4:55.284 kill_command Fluffy_Pillow 64.7/100: 65% focus

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 935 891 891
Agility 3622 3187 3100 (1279)
Stamina 3560 3237 3237
Intellect 895 853 853
Spirit 710 710 710
Health 213600 194220 0
Focus 100 100 0
Crit 27.25% 21.35% 698
Haste 8.70% 3.52% 352
Multistrike 13.74% 8.74% 577
Damage / Heal Versatility 4.23% 1.23% 160
Attack Power 3984 3187 0
Mastery 36.92% 26.42% 573
Armor 1105 1105 1105

Talents

Level
15 Posthaste Narrow Escape Crouching Tiger, Hidden Chimaera
30 Binding Shot Wyvern Sting Intimidation
45 Exhilaration Iron Hawk Spirit Bond
60 Steady Focus Dire Beast Thrill of the Hunt
75 A Murder of Crows Blink Strikes Stampede
90 Glaive Toss Powershot Barrage
100 Exotic Munitions Focusing Shot (Beast Mastery Hunter) Adaptation (Beast Mastery Hunter)

Profile

hunter="Mekkasus"
origin="http://eu.battle.net/wow/en/character/forscherliga/Mekkasus/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/225/48476385-avatar.jpg"
level=100
race=dwarf
role=attack
position=ranged_back
professions=alchemy=603/herbalism=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Ya!2021002
glyphs=animal_bond/disengage/deterrence/tame_beast/fetch/stampede
spec=beast_mastery

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_agility_flask
actions.precombat+=/food,type=blackrock_barbecue
actions.precombat+=/summon_pet
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/exotic_munitions,ammo_type=poisoned,if=active_enemies<3
actions.precombat+=/exotic_munitions,ammo_type=incendiary,if=active_enemies>=3
actions.precombat+=/potion,name=draenic_agility

# Executed every time the actor is available.

actions=auto_shot
actions+=/arcane_torrent,if=focus.deficit>=30
actions+=/blood_fury
actions+=/berserking
actions+=/potion,name=draenic_agility,if=!talent.stampede.enabled&buff.bestial_wrath.up&target.health.pct<=20|target.time_to_die<=20
actions+=/potion,name=draenic_agility,if=talent.stampede.enabled&cooldown.stampede.remains<1&(buff.bloodlust.up|buff.focus_fire.up)|target.time_to_die<=25
actions+=/stampede,if=buff.bloodlust.up|buff.focus_fire.up|target.time_to_die<=25
actions+=/dire_beast
actions+=/explosive_trap,if=active_enemies>1
actions+=/bestial_wrath,if=focus>60&!buff.bestial_wrath.up
actions+=/barrage,if=active_enemies>1
actions+=/multishot,if=active_enemies>5|(active_enemies>1&pet.cat.buff.beast_cleave.down)
actions+=/focus_fire,five_stacks=1
actions+=/barrage,if=active_enemies>1
actions+=/a_murder_of_crows
actions+=/kill_shot,if=focus.time_to_max>gcd
actions+=/kill_command
actions+=/focusing_shot,if=focus<50
# Cast a second shot for steady focus if that won't cap us.
actions+=/cobra_shot,if=buff.pre_steady_focus.up&(14+cast_regen)<=focus.deficit
actions+=/glaive_toss
actions+=/barrage
actions+=/powershot,if=focus.time_to_max>cast_time
actions+=/cobra_shot,if=active_enemies>5
actions+=/arcane_shot,if=(buff.thrill_of_the_hunt.react&focus>35)|buff.bestial_wrath.up
actions+=/arcane_shot,if=focus>=64
actions+=/cobra_shot

head=wayfaring_helm,id=116188,bonus_id=70/525/536
neck=stormshot_choker,id=109950,bonus_id=499/524,enchant=40mult
shoulders=shoulderguards_of_perpetually_exploding_fungus,id=116028
back=dunewalker_wrap,id=118807
chest=wayfaring_tunic,id=116191,bonus_id=106/525/535
wrists=rockhide_wristguards,id=109874,bonus_id=523/524,gems=35mult
hands=sharpeye_gauntlets,id=109853,bonus_id=524
waist=packrunner_belt,id=106745,bonus_id=57
legs=rockhide_leggings,id=109815,bonus_id=523/524,gems=35mult
feet=sharpeye_greaves,id=109791,bonus_id=524
finger1=solium_band_of_dexterity,id=118292,enchant=30mult
finger2=rogers_brown_diamond_seal,id=109759,bonus_id=524,enchant=30mult
trinket1=skull_of_war,id=112318,bonus_id=525/530
trinket2=saberon_protector,id=118682
main_hand=hellscreams_warbow,id=105670,gems=10agi_10agi_8agi,enchant=lord_blastingtons_scope_of_doom

# Gear Summary
# gear_agility=1756
# gear_stamina=2346
# gear_crit_rating=698
# gear_haste_rating=352
# gear_mastery_rating=546
# gear_armor=1105
# gear_multistrike_rating=577
# gear_versatility_rating=160
summon_pet=cat

Rapáx

Rapáx : 22986 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
22986.5 22986.5 4.7 / 0.020% 1487.6 / 6.5% 2367.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.6 8.6 Focus 0.00% 45.4 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Rapáx/advanced
Talents
  • 15: Crouching Tiger, Hidden Chimaera
  • 30: Binding Shot
  • 45: Spirit Bond
  • 60: Thrill of the Hunt
  • 75: A Murder of Crows
  • 90: Barrage
  • 100: Exotic Munitions
  • Talent Calculator
Glyphs
  • Glyph of Liberation
  • Glyph of Deterrence
  • Glyph of Animal Bond
  • Glyph of Aspect of the Pack
  • Glyph of Aspect of the Cheetah
  • Glyph of Tame Beast
Professions
  • leatherworking: 700
  • skinning: 700

Charts

http://8.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Rap%C3%A1x+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x240&chd=t:86989|63142|21569|19398|11485|4069|2183&chds=0,173979&chco=C79C6E,9482C9,C79C6E,C41F3B,69CCF0,ABD473,C79C6E&chm=t++86989++a_murder_of_crows,C79C6E,0,0,15|t++63142++black_arrow,9482C9,1,0,15|t++21569++barrage,C79C6E,2,0,15|t++19398++explosive_shot,C41F3B,3,0,15|t++11485++arcane_shot,69CCF0,4,0,15|t++4069++cobra_shot,ABD473,5,0,15|t++2183++auto_shot,C79C6E,6,0,15& http://9.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Rap%C3%A1x+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:24,15,13,11,9,9,9,8,8,4,4&chds=0,100&chdls=ffffff&chco=C41F3B,ABD473,9482C9,C79C6E,C79C6E,ABD473,C79C6E,69CCF0,C79C6E,ABD473,C79C6E&chl=explosive_shot|serpent_sting|black_arrow|barrage|auto_shot|cobra_shot|cat: melee|arcane_shot|crow_peck|poisoned_ammo|cat: claw&
http://1.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Rap%C3%A1x+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:adgkmquy144787542100yywuusqppopoopopqpooomnmllljkjiiiijjjkllmnnoooppoppooonnnnmmmmmlmmlllkkkjkjjjjjiiiiiiijjjkkllkkkkkkkkkkllllmmmnnnpppqpppoonnmmllkkjjjiijijjjkklkkkkjkjjjjjjijijjjkkkmlmnnoooooooooonnnnmmmmlmlllllkklkkkkkjjkjjjkkjklllllmmlmmmmmmmmnnnoooopppqrrrrrrqqqpooonmmlllllllmmmmmmmnnmmmmmmmmmmmmmmmoooppqrrssststtttsttrssrsrrsrrrrsrrsrsrrsrrrrrsrssssrssrrpnmjhfcaYVT&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.66103,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=22986|max=34774&chxp=1,1,66,100 http://4.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Rap%C3%A1x+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:4,4,16,17,32,51,83,114,218,271,349,478,663,854,1036,1127,1263,1378,1518,1528,1613,1564,1540,1436,1296,1128,960,869,761,622,540,415,341,259,188,136,104,80,41,34,24,22,10,7,3,0,1,0,0,2&chds=0,1613&chbh=5&chxt=x&chxl=0:|min=21717|avg=22986|max=24718&chxp=0,1,42,100& http://0.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Rap%C3%A1x+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:44.3,24.8,14.3,10.7,4.2,1.8&chds=0,100&chdls=ffffff&chco=ABD473,C41F3B,69CCF0,C79C6E,9482C9,C79C6E&chl=cobra_shot 133.2s|explosive_shot 74.6s|arcane_shot 43.0s|barrage 32.1s|black_arrow 12.5s|a_murder_of_crows 5.3s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Rapáx 22986
a_murder_of_crows 0 (1536) 0.0% (6.7%) 5.3 62.18sec 87372 86989

Stats details: a_murder_of_crows

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.28 5.28 77.45 77.45 1.0045 1.0000 0.00 0.00 0.00 5578.61 86989.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.28 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.4 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: a_murder_of_crows

Static Values
  • id:131894
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131894
  • name:A Murder of Crows
  • school:physical
  • tooltip:Under attack by a flock of crows.
  • description:Summons a flock of crows to attack your target over the next {$d=15 seconds}. If the target dies while under attack, A Murder of Crows' cooldown is reset.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
 
    crow_peck 1536 6.7% 0.0 0.00sec 0 0 Direct 77.4 4110 8254 5501 33.6% 21.6 1233 2476 33.5%  

Stats details: crow_peck

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 77.45 0.00 0.00 0.0000 0.0000 461652.27 709486.65 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 7.24 33.55% 2476.03 2317 2899 2475.13 0 2899 17932 27559 34.91
multistrike 14.35 66.45% 1232.92 1158 1449 1233.39 1158 1449 17687 27183 34.93
hit 51.46 66.44% 4110.33 3861 4831 4111.66 3908 4392 211500 325042 34.93
crit 25.99 33.56% 8253.99 7722 9662 8257.68 7722 9231 214533 329703 34.93
 
DPS Timeline Chart
 

Action details: crow_peck

Static Values
  • id:131900
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131900
  • name:A Murder of Crows
  • school:physical
  • tooltip:
  • description:Deals {$s1=1} physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.170000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
arcane_shot 1646 7.2% 42.8 7.05sec 11536 11485 Direct 42.5 7914 15852 10555 33.3% 11.9 2849 5708 33.3%  

Stats details: arcane_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.84 42.54 0.00 0.00 1.0045 0.0000 494214.04 494214.04 0.00 11484.80 11484.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.96 33.33% 5707.96 5512 6582 5586.79 0 6582 22605 22605 0.00
multistrike 7.92 66.67% 2849.17 2756 3291 2848.89 0 3291 22572 22572 0.00
hit 28.38 66.72% 7913.65 7656 9142 7916.64 7656 8434 224622 224622 0.00
crit 14.16 33.28% 15852.19 15312 18284 15858.04 15312 17689 224414 224414 0.00
 
DPS Timeline Chart
 

Action details: arcane_shot

Static Values
  • id:3044
  • school:arcane
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.000
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.thrill_of_the_hunt.react&focus>35&cast_regen<=focus.deficit|dot.serpent_sting.remains<=3|target.time_to_die<4.5
Spelldata
  • id:3044
  • name:Arcane Shot
  • school:arcane
  • tooltip:
  • description:An instant shot that causes $sw2 Arcane damage.$?p131564[ Grants {$142978s1=122} PvP Power for {$142978d=6 seconds}.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.26
 
auto_shot 1925 8.4% 106.0 2.85sec 5458 2183 Direct 106.0 3718 7450 4959 33.3% 29.6 1339 2682 33.3%  

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 106.02 106.02 0.00 0.00 2.5007 0.0000 578644.93 889285.89 34.93 2182.64 2182.64
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 9.87 33.31% 2681.94 2596 3107 2683.06 2596 3107 26460 40665 34.93
multistrike 19.75 66.69% 1338.84 1298 1554 1339.45 1298 1475 26442 40637 34.93
hit 70.76 66.75% 3718.22 3605 4315 3719.86 3640 3823 263120 404374 34.93
crit 35.25 33.25% 7450.16 7210 8631 7453.83 7210 7886 262623 403610 34.93
 
DPS Timeline Chart
 

Action details: auto_shot

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
barrage 2303 10.0% 11.6 25.44sec 59515 21569 Periodic 185.8 2426 4857 3229 33.1% 52.0 1342 2688 33.0% 9.7%

Stats details: barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.64 11.64 186.30 185.81 2.7593 0.1569 692971.77 1015094.55 31.73 21569.09 21569.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.64 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 17.2 33.01% 2687.67 2608 3115 2688.80 2608 2970 46156 46156 0.00
multistrike 34.8 66.99% 1342.44 1304 1557 1342.97 1304 1443 46783 46783 0.00
hit 124.4 66.95% 2425.79 2357 2815 2426.84 2357 2523 301767 463767 34.93
crit 61.4 33.05% 4856.80 4715 5630 4858.90 4715 5153 298266 458388 34.93
 
DPS Timeline Chart
 

Action details: barrage

Static Values
  • id:120360
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120360
  • name:Barrage
  • school:physical
  • tooltip:
  • description:Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the enemy target and an average of $<damageSec> Physical damage to each other enemy target in front of you. Usable while moving.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: barrage_primary

Static Values
  • id:120361
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120361
  • name:Barrage
  • school:physical
  • tooltip:
  • description:{$@spelldesc120360=Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the enemy target and an average of $<damageSec> Physical damage to each other enemy target in front of you. Usable while moving.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.69
 
black_arrow 2633 11.5% 12.5 25.02sec 63426 63142 Periodic 120.7 4472 8959 5962 33.2% 33.8 1610 3225 33.2% 80.2%

Stats details: black_arrow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.48 12.47 120.67 120.67 1.0045 2.0000 791866.18 791866.18 0.00 3119.11 63142.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.36 67.06% 0.00 0 0 0.00 0 0 0 0 0.00
crit 4.11 32.94% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 11.2 33.23% 3225.38 3102 3881 3227.16 0 3881 36179 36179 0.00
multistrike 22.5 66.77% 1610.14 1551 1940 1611.20 1551 1773 36292 36292 0.00
hit 80.6 66.80% 4472.21 4308 5390 4474.85 4347 4614 360497 360497 0.00
crit 40.1 33.20% 8959.02 8616 10779 8964.46 8616 9481 358899 358899 0.00
 
DPS Timeline Chart
 

Action details: black_arrow

Static Values
  • id:3674
  • school:shadow
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:24.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:3674
  • name:Black Arrow
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1 seconds.
  • description:Fires a Black Arrow at the target, dealing $3674o1 damage over {$3674d=20 seconds}. Your Black Arrow periodic damage has a {$s2=20}% chance to trigger Lock and Load, causing your next two Explosive Shots to cost no Focus and trigger no cooldown. When Black Arrow is dispelled, its cooldown is reset.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.566720
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
cobra_shot 1802 7.8% 78.7 3.75sec 6888 4069 Direct 78.5 4711 9433 6273 33.1% 21.9 1696 3396 33.1%  

Stats details: cobra_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.71 78.53 0.00 0.00 1.6928 0.0000 542115.98 542115.98 0.00 4068.87 4068.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 7.26 33.12% 3396.44 3307 3949 3394.71 0 3949 24652 24652 0.00
multistrike 14.66 66.88% 1696.00 1654 1975 1696.66 1654 1910 24863 24863 0.00
hit 52.56 66.93% 4711.35 4594 5485 4713.19 4610 4891 247636 247636 0.00
crit 25.97 33.07% 9433.50 9187 10970 9437.49 9187 10026 244964 244964 0.00
 
DPS Timeline Chart
 

Action details: cobra_shot

Static Values
  • id:77767
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.pre_steady_focus.up&buff.steady_focus.remains<5&(14+cast_regen)<=focus.deficit<80
Spelldata
  • id:77767
  • name:Cobra Shot
  • school:nature
  • tooltip:
  • description:Deals $sw2 Nature damage and generates {$91954s1=14} Focus. Usable while moving.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.76
 
explosive_shot 4813 20.9% 74.3 4.05sec 19485 19398 Direct 74.0 3354 6722 4474 33.2% 20.7 1208 2419 33.3%  
Periodic 167.4 4408 8823 5876 33.3% 46.7 1588 3177 33.3% 55.6%

Stats details: explosive_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.27 74.05 167.42 167.42 1.0045 1.0000 1447271.19 1447271.19 0.00 5979.84 19398.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 6.89 33.27% 2419.03 2326 2910 2416.62 0 2910 16657 16657 0.00
multistrike 13.81 66.73% 1207.74 1163 1455 1208.54 1163 1407 16681 16681 0.00
hit 49.44 66.76% 3354.34 3231 4042 3356.17 3231 3560 165827 165827 0.00
crit 24.61 33.24% 6721.90 6462 8085 6725.78 6462 7363 165439 165439 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 15.6 33.30% 3176.68 2326 8445 3176.72 2326 4756 49414 49414 0.00
multistrike 31.2 66.70% 1587.68 1163 4142 1587.60 1224 2149 49475 49475 0.00
hit 111.8 66.75% 4408.48 3231 11729 4408.31 3946 5234 492649 492649 0.00
crit 55.7 33.25% 8822.69 6462 23457 8823.36 7440 10885 491129 491129 0.00
 
DPS Timeline Chart
 

Action details: explosive_shot

Static Values
  • id:53301
  • school:fire
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53301
  • name:Explosive Shot
  • school:fire
  • tooltip:Taking Fire damage every second.
  • description:You fire an explosive charge into the enemy target, dealing ${$<explosive>} Fire damage initially and every second for {$d=2 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.552552
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 

Action details: explosive_shot_tick

Static Values
  • id:53301
  • school:fire
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53301
  • name:Explosive Shot
  • school:fire
  • tooltip:Taking Fire damage every second.
  • description:You fire an explosive charge into the enemy target, dealing ${$<explosive>} Fire damage initially and every second for {$d=2 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:3.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
poisoned_ammo 816 3.6% 106.0 2.85sec 2317 0 Periodic 149.9 1231 2453 1638 33.3% 0.0 0 0 0.0% 99.6%

Stats details: poisoned_ammo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 106.00 0.00 149.90 149.90 0.0000 2.0000 245572.14 245572.14 0.00 819.10 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 100.0 66.68% 1231.25 278 1694 1231.80 1185 1307 123071 123071 0.00
crit 49.9 33.32% 2452.58 556 3388 2453.42 2262 2657 122501 122501 0.00
 
DPS Timeline Chart
 

Action details: poisoned_ammo

Static Values
  • id:170661
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:170661
  • name:Poisoned Ammo
  • school:nature
  • tooltip:Deals $w1 Nature damage every $t sec.
  • description:{$@spelldesc162537=Arms your ranged weapon with exotic ammunition that lasts for {$d=3600 seconds}. Each autoshot deals $170661o1 additional Nature damage over {$162543d=16 seconds}. When this effect is refreshed, the remaining damage will be added to the new effect.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
serpent_sting 2982 13.0% 42.5 7.07sec 21075 0 Periodic 140.4 4352 8715 5797 33.1% 39.2 1580 3164 33.2% 97.6%

Stats details: serpent_sting

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.54 42.54 140.41 140.41 0.0000 2.0911 896547.63 896547.63 0.00 3053.45 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.39 66.74% 0.00 0 0 0.00 0 0 0 0 0.00
crit 14.15 33.26% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 13.0 33.22% 3164.19 3053 3820 3165.75 3053 3820 41202 41202 0.00
multistrike 26.2 66.78% 1580.05 1526 1910 1580.75 1526 1750 41358 41358 0.00
hit 93.9 66.88% 4352.17 0 5305 4354.33 4135 4524 408734 408734 0.00
crit 46.5 33.12% 8715.37 3 10610 8719.95 8063 9295 405253 405253 0.00
 
DPS Timeline Chart
 

Action details: serpent_sting

Static Values
  • id:118253
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118253
  • name:Serpent Sting
  • school:nature
  • tooltip:Causes $w1 Nature damage every $t1 seconds.
  • description:Causes $o1 Nature damage over {$d=15 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.725402
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - cat 2530 / 2530
claw 739 3.2% 73.0 4.17sec 3039 3026 Direct 73.0 1948 3928 2804 43.3% 20.4 585 1179 43.3%  

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.99 72.99 0.00 0.00 1.0045 0.0000 221840.68 340934.10 34.93 3025.77 3025.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 8.81 43.28% 1178.87 1089 2725 1179.96 0 2725 10390 15968 34.93
multistrike 11.55 56.72% 584.61 544 1362 585.34 544 988 6752 10377 34.93
hit 41.42 56.74% 1948.38 1815 4541 1950.26 1815 2156 80697 124019 34.93
crit 31.57 43.26% 3927.54 3629 9082 3931.78 3629 4539 124001 190569 34.93
 
DPS Timeline Chart
 

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, causing ${$<damage>} damage. Deals {$62762s2=100}% more damage and costs {$62762s1=100}% more Focus when your pet has 50 or more Focus.
 
melee 1791 7.8% 196.5 1.53sec 2739 1793 Direct 196.5 1763 3532 2527 43.2% 54.9 529 1060 43.2%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 196.51 196.51 0.00 0.00 1.5274 0.0000 538284.33 827258.03 34.93 1793.38 1793.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 23.73 43.20% 1059.69 1018 1274 1060.33 1018 1181 25144 38643 34.93
multistrike 31.19 56.80% 528.96 509 637 529.25 509 573 16499 25357 34.93
hit 111.64 56.81% 1763.13 1697 2123 1764.11 1723 1820 196830 302496 34.93
crit 84.88 43.19% 3532.23 3394 4246 3534.30 3422 3682 299811 460763 34.93
 
DPS Timeline Chart
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Simple Action Stats Execute Interval
Rapáx
draenic_agility_potion 2.0 0.00sec

Stats details: draenic_agility_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156423
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156423
  • name:Draenic Agility Potion
  • school:physical
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
 
exotic_munitions 1.0 0.00sec

Stats details: exotic_munitions

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 1.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: exotic_munitions

Static Values
  • id:162534
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:active_enemies<3
Spelldata
  • id:162534
  • name:Exotic Munitions
  • school:physical
  • tooltip:
  • description:Allows you to modify your ranged weapon to use exotic munitions: $@spellname162536 {$@spelldesc162536=Arms your ranged weapon with exotic ammunition that lasts for {$d=3600 seconds}. Each autoshot deals $162541sw1 additional Fire damage to all enemies within $162541A1 yards of the initial target.} $@spellname162537 {$@spelldesc162537=Arms your ranged weapon with exotic ammunition that lasts for {$d=3600 seconds}. Each autoshot deals $170661o1 additional Nature damage over {$162543d=16 seconds}. When this effect is refreshed, the remaining damage will be added to the new effect.} $@spellname162539 {$@spelldesc162539=Arms your ranged weapon with exotic ammunition that lasts for {$d=3600 seconds}. Each autoshot deals $162546sw1 additional Frost damage and reduces the target's movement speed by {$162546s2=50}% for {$162546d=4 seconds}.} Only one exotic munition can be active at one time.
 
summon_pet 1.0 0.00sec

Stats details: summon_pet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: summon_pet

Static Values
  • id:0
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 42.86% 0.0(0.0)

Buff details

  • buff initial source:Rapáx
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
draenic_agility_potion 2.0 0.0 276.2sec 0.0sec 14.87% 14.88% 0.0(0.0)

Buff details

  • buff initial source:Rapáx
  • cooldown name:buff_draenic_agility_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:1000.00

Stack Uptimes

  • draenic_agility_potion_1:14.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156423
  • name:Draenic Agility Potion
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
lock_and_load 14.9 0.2 20.0sec 19.7sec 8.75% 39.96% 0.2(0.2)

Buff details

  • buff initial source:Rapáx
  • cooldown name:buff_lock_and_load
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • lock_and_load_1:4.98%
  • lock_and_load_2:3.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:168980
  • name:Lock and Load
  • tooltip:Your Explosive Shot triggers no cooldown.
  • description:{$@spelldesc3674=Fires a Black Arrow at the target, dealing $3674o1 damage over {$3674d=20 seconds}. Your Black Arrow periodic damage has a {$s2=20}% chance to trigger Lock and Load, causing your next two Explosive Shots to cost no Focus and trigger no cooldown. When Black Arrow is dispelled, its cooldown is reset.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
megawatt_filament 7.2 2.4 43.9sec 31.6sec 32.74% 32.75% 2.4(2.4)

Buff details

  • buff initial source:Rapáx
  • cooldown name:buff_megawatt_filament
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:crit_rating
  • amount:750.00

Stack Uptimes

  • megawatt_filament_1:32.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156060
  • name:Megawatt Filament
  • tooltip:Critical strike increased by $w1.
  • description:Critical strike increased by {$s1=750}.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
thrill_of_the_hunt 10.9 3.7 27.2sec 19.9sec 33.02% 79.35% 3.7(7.8)

Buff details

  • buff initial source:Rapáx
  • cooldown name:buff_thrill_of_the_hunt
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • thrill_of_the_hunt_1:7.69%
  • thrill_of_the_hunt_2:10.61%
  • thrill_of_the_hunt_3:14.72%

Trigger Attempt Success

  • trigger_pct:13.05%

Spelldata details

  • id:34720
  • name:Thrill of the Hunt
  • tooltip:Reduces the Focus cost of your next Arcane Shot, Aimed Shot, or Multi-Shot by {$s1=20}.
  • description:{$@spelldesc109306=You have a {$s1=6}% chance per 10 Focus spent on Focus-costing attacks to trigger Thrill of the Hunt. Thrill of the Hunt reduces the Focus cost of your next {$s2=3} Arcane Shots, Aimed Shots, or Multi-Shots by {$34720s1=20}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_agility_flask

Buff details

  • buff initial source:Rapáx
  • cooldown name:buff_greater_draenic_agility_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:250.00

Stack Uptimes

  • greater_draenic_agility_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156064
  • name:Greater Draenic Agility Flask
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Rapáx
a_murder_of_crows Focus 5.3 158.5 30.0 30.0 2912.4
arcane_shot Focus 42.8 636.6 14.9 14.9 776.3
barrage Focus 11.6 698.6 60.0 60.0 991.9
black_arrow Focus 12.5 437.0 35.0 35.0 1812.2
explosive_shot Focus 74.3 667.3 9.0 9.0 2168.7
pet - cat
claw Focus 73.0 1874.7 25.7 25.7 118.3
Resource Gains Type Count Total Average Overflow
focus_regen Focus 224.66 1420.66 (44.35%) 6.32 8.73 0.61%
external_healing Health 8.02 0.00 (0.00%) 0.00 75585.59 100.00%
thrill_of_the_hunt_savings Focus 34.30 686.08 (21.42%) 20.00 0.00 0.00%
cobra_shot Focus 78.53 1096.83 (34.24%) 13.97 2.58 0.23%
pet - cat
focus_regen Focus 300.45 1787.14 (100.00%) 5.95 0.00 0.00%
Resource RPS-Gain RPS-Loss
Focus 8.37 8.63
Combat End Resource Mean Min Max
Focus 19.60 0.00 100.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Focus Cap 0.3%
cat-Focus Cap 0.3%
devilsaur-Focus Cap 0.3%
raptor-Focus Cap 0.3%
hyena-Focus Cap 0.3%
wolf-Focus Cap 0.3%
wasp-Focus Cap 0.3%
t17_pet_2-Focus Cap 0.3%
t17_pet_1-Focus Cap 0.3%
dire_beast_1-Focus Cap 0.3%
dire_beast_2-Focus Cap 0.3%
tier15_thunderhawk-Focus Cap 0.3%
tier15_thunderhawk-Focus Cap 0.3%
tier15_thunderhawk-Focus Cap 0.3%
tier15_thunderhawk-Focus Cap 0.3%
tier15_thunderhawk-Focus Cap 0.3%
tier15_thunderhawk-Focus Cap 0.3%
tier15_thunderhawk-Focus Cap 0.3%
tier15_thunderhawk-Focus Cap 0.3%
tier15_thunderhawk-Focus Cap 0.3%
tier15_thunderhawk-Focus Cap 0.3%

Procs

Count Interval
starved: black_arrow 2.3 34.0sec
starved: explosive_shot 0.7 54.7sec
starved: a_murder_of_crows 1.3 41.5sec
starved: barrage 16.7 17.4sec
thrill_of_the_hunt 14.6 19.8sec
lock_and_load 15.1 19.7sec

Statistics & Data Analysis

Fight Length
Sample Data Rapáx Fight Length
Count 25000
Mean 300.94
Minimum 230.43
Maximum 374.11
Spread ( max - min ) 143.68
Range [ ( max - min ) / 2 * 100% ] 23.87%
DPS
Sample Data Rapáx Damage Per Second
Count 25000
Mean 22986.46
Minimum 21716.99
Maximum 24717.81
Spread ( max - min ) 3000.82
Range [ ( max - min ) / 2 * 100% ] 6.53%
Standard Deviation 379.7779
5th Percentile 22390.29
95th Percentile 23637.63
( 95th Percentile - 5th Percentile ) 1247.34
Mean Distribution
Standard Deviation 2.4019
95.00% Confidence Intervall ( 22981.76 - 22991.17 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 10
0.1% Error 1048
0.1 Scale Factor Error with Delta=300 1231
0.05 Scale Factor Error with Delta=300 4924
0.01 Scale Factor Error with Delta=300 123124
Distribution Chart
DPS(e)
Sample Data Rapáx Damage Per Second (Effective)
Count 25000
Mean 22986.46
Minimum 21716.99
Maximum 24717.81
Spread ( max - min ) 3000.82
Range [ ( max - min ) / 2 * 100% ] 6.53%
Damage
Sample Data Rapáx Damage
Count 25000
Mean 6150856.12
Minimum 4607674.95
Maximum 7801387.08
Spread ( max - min ) 3193712.13
Range [ ( max - min ) / 2 * 100% ] 25.96%
DTPS
Sample Data Rapáx Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Rapáx Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Rapáx Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Rapáx Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Rapáx Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Rapáx Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data RapáxTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Rapáx Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_agility_flask
1 0.00 food,type=blackrock_barbecue
2 0.00 summon_pet
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 exotic_munitions,ammo_type=poisoned,if=active_enemies<3
5 0.00 exotic_munitions,ammo_type=incendiary,if=active_enemies>=3
6 0.00 potion,name=draenic_agility
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 auto_shot
8 0.00 arcane_torrent,if=focus.deficit>=30
9 0.00 blood_fury
A 0.00 berserking
B 1.00 potion,name=draenic_agility,if=(((cooldown.stampede.remains<1)&(cooldown.a_murder_of_crows.remains<1))&(trinket.stat.any.up|buff.archmages_greater_incandescence_agi.up))|target.time_to_die<=25
C 0.00 call_action_list,name=aoe,if=active_enemies>1
D 0.00 stampede,if=buff.potion.up|(cooldown.potion.remains&(buff.archmages_greater_incandescence_agi.up|trinket.stat.any.up))|target.time_to_die<=25
E 12.48 black_arrow,if=!ticking
F 74.28 explosive_shot
G 5.28 a_murder_of_crows
H 0.00 dire_beast
I 39.72 arcane_shot,if=buff.thrill_of_the_hunt.react&focus>35&cast_regen<=focus.deficit|dot.serpent_sting.remains<=3|target.time_to_die<4.5
J 0.00 glaive_toss
K 0.00 powershot
L 11.64 barrage
M 0.00 cobra_shot,if=buff.pre_steady_focus.up&buff.steady_focus.remains<5&(14+cast_regen)<=focus.deficit<80
Cast a second shot for steady focus if that won't cap us.
N 3.12 arcane_shot,if=focus>=80|talent.focusing_shot.enabled
O 0.00 focusing_shot
P 79.13 cobra_shot

Sample Sequence

012467EFGIPIIFPPLIFFFFPPIIIFEPPPFPLPPFNPFFFIIPNPEFPPLFPPGFFFIPPPFEIIFFFIPPLFPPPFNPPEFPFFFLPPFIIIFFFPFFEFPPFFFGPIPFPPLFPEPIFPPPFPPLFFFIPPEFPPPFFFIIILFPPGIFPPEPFIPFFFFLPPFPPIPEFPPNLFPFFFPPFFFPIEIIFPPGPFPPLFPIBFFFPEPPFPPILFPPIIFF

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 100.0/100: 100% focus
Pre food Fluffy_Pillow 100.0/100: 100% focus
Pre summon_pet Fluffy_Pillow 100.0/100: 100% focus
Pre exotic_munitions Fluffy_Pillow 100.0/100: 100% focus
Pre potion Fluffy_Pillow 100.0/100: 100% focus draenic_agility_potion
0:00.000 start_auto_shot Fluffy_Pillow 100.0/100: 100% focus draenic_agility_potion
0:00.000 black_arrow Fluffy_Pillow 100.0/100: 100% focus draenic_agility_potion
0:01.004 explosive_shot Fluffy_Pillow 71.0/100: 71% focus bloodlust, thrill_of_the_hunt(3), megawatt_filament, draenic_agility_potion
0:02.010 a_murder_of_crows Fluffy_Pillow 62.0/100: 62% focus bloodlust, thrill_of_the_hunt(3), megawatt_filament, draenic_agility_potion
0:03.014 arcane_shot Fluffy_Pillow 37.9/100: 38% focus bloodlust, thrill_of_the_hunt(3), megawatt_filament, draenic_agility_potion
0:04.019 cobra_shot Fluffy_Pillow 33.9/100: 34% focus bloodlust, thrill_of_the_hunt(2), megawatt_filament, draenic_agility_potion
0:05.367 arcane_shot Fluffy_Pillow 41.9/100: 42% focus bloodlust, thrill_of_the_hunt(2), megawatt_filament, draenic_agility_potion
0:06.371 arcane_shot Fluffy_Pillow 51.9/100: 52% focus bloodlust, thrill_of_the_hunt, megawatt_filament, draenic_agility_potion
0:07.375 explosive_shot Fluffy_Pillow 47.9/100: 48% focus bloodlust, megawatt_filament, draenic_agility_potion
0:08.379 cobra_shot Fluffy_Pillow 38.8/100: 39% focus bloodlust, megawatt_filament, draenic_agility_potion
0:09.727 cobra_shot Fluffy_Pillow 46.9/100: 47% focus bloodlust, megawatt_filament, draenic_agility_potion
0:11.074 barrage Fluffy_Pillow 68.9/100: 69% focus bloodlust, thrill_of_the_hunt(3), megawatt_filament, draenic_agility_potion
0:13.261 arcane_shot Fluffy_Pillow 35.9/100: 36% focus bloodlust, thrill_of_the_hunt(3), draenic_agility_potion
0:14.266 explosive_shot Fluffy_Pillow 31.9/100: 32% focus bloodlust, thrill_of_the_hunt(2), draenic_agility_potion
0:15.272 explosive_shot Fluffy_Pillow 22.8/100: 23% focus bloodlust, thrill_of_the_hunt(2), lock_and_load(2), draenic_agility_potion
0:16.278 explosive_shot Fluffy_Pillow 28.8/100: 29% focus bloodlust, thrill_of_the_hunt(2), lock_and_load, draenic_agility_potion
0:17.283 explosive_shot Fluffy_Pillow 34.8/100: 35% focus bloodlust, thrill_of_the_hunt(2), draenic_agility_potion
0:18.290 cobra_shot Fluffy_Pillow 25.8/100: 26% focus bloodlust, thrill_of_the_hunt(2), draenic_agility_potion
0:19.637 cobra_shot Fluffy_Pillow 33.8/100: 34% focus bloodlust, thrill_of_the_hunt(2), draenic_agility_potion
0:20.987 arcane_shot Fluffy_Pillow 55.8/100: 56% focus bloodlust, thrill_of_the_hunt(2)
0:21.991 arcane_shot Fluffy_Pillow 65.8/100: 66% focus bloodlust, thrill_of_the_hunt(2)
0:22.995 arcane_shot Fluffy_Pillow 61.8/100: 62% focus bloodlust, thrill_of_the_hunt
0:23.999 explosive_shot Fluffy_Pillow 57.8/100: 58% focus bloodlust
0:25.002 black_arrow Fluffy_Pillow 48.7/100: 49% focus bloodlust
0:26.007 cobra_shot Fluffy_Pillow 19.7/100: 20% focus bloodlust
0:27.355 cobra_shot Fluffy_Pillow 27.7/100: 28% focus bloodlust
0:28.703 cobra_shot Fluffy_Pillow 49.7/100: 50% focus bloodlust
0:30.052 explosive_shot Fluffy_Pillow 71.8/100: 72% focus bloodlust
0:31.055 cobra_shot Fluffy_Pillow 76.7/100: 77% focus bloodlust
0:32.403 barrage Fluffy_Pillow 84.8/100: 85% focus bloodlust
0:34.649 cobra_shot Fluffy_Pillow 52.1/100: 52% focus bloodlust
0:35.998 cobra_shot Fluffy_Pillow 60.1/100: 60% focus bloodlust
0:37.347 explosive_shot Fluffy_Pillow 82.2/100: 82% focus bloodlust
0:38.351 arcane_shot Fluffy_Pillow 87.1/100: 87% focus bloodlust
0:39.354 cobra_shot Fluffy_Pillow 63.1/100: 63% focus bloodlust, thrill_of_the_hunt(2)
0:40.704 explosive_shot Fluffy_Pillow 71.1/100: 71% focus bloodlust, thrill_of_the_hunt(2), lock_and_load(2)
0:41.709 explosive_shot Fluffy_Pillow 89.7/100: 90% focus thrill_of_the_hunt(2), lock_and_load
0:42.714 explosive_shot Fluffy_Pillow 94.3/100: 94% focus thrill_of_the_hunt(2)
0:43.720 arcane_shot Fluffy_Pillow 83.9/100: 84% focus thrill_of_the_hunt(2)
0:44.724 arcane_shot Fluffy_Pillow 78.5/100: 79% focus thrill_of_the_hunt
0:45.727 cobra_shot Fluffy_Pillow 73.1/100: 73% focus
0:47.480 arcane_shot Fluffy_Pillow 81.1/100: 81% focus
0:48.484 cobra_shot Fluffy_Pillow 69.7/100: 70% focus
0:50.235 black_arrow Fluffy_Pillow 77.7/100: 78% focus
0:51.240 explosive_shot Fluffy_Pillow 61.3/100: 61% focus
0:52.245 cobra_shot Fluffy_Pillow 50.9/100: 51% focus
0:53.998 cobra_shot Fluffy_Pillow 59.0/100: 59% focus
0:55.753 barrage Fluffy_Pillow 81.0/100: 81% focus
0:58.692 explosive_shot Fluffy_Pillow 48.4/100: 48% focus
0:59.696 cobra_shot Fluffy_Pillow 38.0/100: 38% focus megawatt_filament
1:01.449 cobra_shot Fluffy_Pillow 46.1/100: 46% focus megawatt_filament
1:03.201 a_murder_of_crows Fluffy_Pillow 68.1/100: 68% focus megawatt_filament
1:04.206 explosive_shot Fluffy_Pillow 56.7/100: 57% focus lock_and_load(2), megawatt_filament
1:05.209 explosive_shot Fluffy_Pillow 61.3/100: 61% focus lock_and_load, megawatt_filament
1:06.212 explosive_shot Fluffy_Pillow 65.9/100: 66% focus megawatt_filament
1:07.217 arcane_shot Fluffy_Pillow 55.5/100: 55% focus megawatt_filament
1:08.222 cobra_shot Fluffy_Pillow 30.0/100: 30% focus megawatt_filament
1:09.974 cobra_shot Fluffy_Pillow 38.1/100: 38% focus megawatt_filament
1:11.726 cobra_shot Fluffy_Pillow 60.1/100: 60% focus
1:13.477 explosive_shot Fluffy_Pillow 82.1/100: 82% focus megawatt_filament
1:14.482 black_arrow Fluffy_Pillow 85.7/100: 86% focus megawatt_filament
1:15.487 arcane_shot Fluffy_Pillow 55.3/100: 55% focus thrill_of_the_hunt(3), megawatt_filament
1:16.492 arcane_shot Fluffy_Pillow 49.9/100: 50% focus thrill_of_the_hunt(2), megawatt_filament
1:17.496 explosive_shot Fluffy_Pillow 44.5/100: 44% focus thrill_of_the_hunt, lock_and_load(2), megawatt_filament
1:18.499 explosive_shot Fluffy_Pillow 49.1/100: 49% focus thrill_of_the_hunt, lock_and_load, megawatt_filament
1:19.504 explosive_shot Fluffy_Pillow 53.7/100: 54% focus thrill_of_the_hunt, megawatt_filament
1:20.509 arcane_shot Fluffy_Pillow 43.3/100: 43% focus thrill_of_the_hunt, megawatt_filament
1:21.514 cobra_shot Fluffy_Pillow 37.9/100: 38% focus megawatt_filament
1:23.266 cobra_shot Fluffy_Pillow 45.9/100: 46% focus megawatt_filament
1:25.019 barrage Fluffy_Pillow 67.9/100: 68% focus
1:27.860 explosive_shot Fluffy_Pillow 34.9/100: 35% focus
1:28.862 cobra_shot Fluffy_Pillow 24.5/100: 24% focus
1:30.615 cobra_shot Fluffy_Pillow 32.5/100: 33% focus
1:32.368 cobra_shot Fluffy_Pillow 54.5/100: 55% focus
1:34.122 explosive_shot Fluffy_Pillow 76.6/100: 77% focus
1:35.127 arcane_shot Fluffy_Pillow 80.2/100: 80% focus
1:36.132 cobra_shot Fluffy_Pillow 54.8/100: 55% focus
1:37.886 cobra_shot Fluffy_Pillow 62.8/100: 63% focus
1:39.640 black_arrow Fluffy_Pillow 84.8/100: 85% focus
1:40.644 explosive_shot Fluffy_Pillow 68.4/100: 68% focus
1:41.647 cobra_shot Fluffy_Pillow 58.0/100: 58% focus
1:43.399 explosive_shot Fluffy_Pillow 66.0/100: 66% focus lock_and_load(2)
1:44.403 explosive_shot Fluffy_Pillow 84.6/100: 85% focus lock_and_load
1:45.406 explosive_shot Fluffy_Pillow 89.2/100: 89% focus
1:46.410 barrage Fluffy_Pillow 78.8/100: 79% focus
1:49.358 cobra_shot Fluffy_Pillow 32.3/100: 32% focus
1:51.112 cobra_shot Fluffy_Pillow 40.3/100: 40% focus
1:52.865 explosive_shot Fluffy_Pillow 62.3/100: 62% focus
1:53.870 arcane_shot Fluffy_Pillow 65.9/100: 66% focus
1:54.874 arcane_shot Fluffy_Pillow 40.5/100: 41% focus thrill_of_the_hunt(2)
1:55.878 arcane_shot Fluffy_Pillow 35.1/100: 35% focus thrill_of_the_hunt
1:56.883 explosive_shot Fluffy_Pillow 29.7/100: 30% focus lock_and_load(2)
1:57.890 explosive_shot Fluffy_Pillow 34.3/100: 34% focus lock_and_load
1:58.895 explosive_shot Fluffy_Pillow 38.9/100: 39% focus megawatt_filament
1:59.901 cobra_shot Fluffy_Pillow 28.5/100: 29% focus megawatt_filament
2:01.653 explosive_shot Fluffy_Pillow 36.5/100: 37% focus lock_and_load(2), megawatt_filament
2:02.657 explosive_shot Fluffy_Pillow 55.1/100: 55% focus lock_and_load, megawatt_filament
2:03.661 black_arrow Fluffy_Pillow 59.7/100: 60% focus megawatt_filament
2:04.665 explosive_shot Fluffy_Pillow 29.3/100: 29% focus megawatt_filament
2:05.670 cobra_shot Fluffy_Pillow 18.9/100: 19% focus megawatt_filament
2:07.422 cobra_shot Fluffy_Pillow 26.9/100: 27% focus megawatt_filament
2:09.173 explosive_shot Fluffy_Pillow 49.0/100: 49% focus lock_and_load(2), megawatt_filament
2:10.175 explosive_shot Fluffy_Pillow 67.5/100: 68% focus lock_and_load
2:11.181 explosive_shot Fluffy_Pillow 72.1/100: 72% focus
2:12.186 a_murder_of_crows Fluffy_Pillow 61.7/100: 62% focus
2:13.191 cobra_shot Fluffy_Pillow 36.3/100: 36% focus
2:14.943 arcane_shot Fluffy_Pillow 44.4/100: 44% focus
2:15.949 cobra_shot Fluffy_Pillow 33.0/100: 33% focus
2:17.701 explosive_shot Fluffy_Pillow 41.0/100: 41% focus
2:18.706 cobra_shot Fluffy_Pillow 44.6/100: 45% focus
2:20.458 cobra_shot Fluffy_Pillow 52.6/100: 53% focus
2:22.210 barrage Fluffy_Pillow 74.6/100: 75% focus
2:25.207 explosive_shot Fluffy_Pillow 42.3/100: 42% focus
2:26.211 cobra_shot Fluffy_Pillow 31.9/100: 32% focus
2:27.963 black_arrow Fluffy_Pillow 39.9/100: 40% focus
2:28.966 cobra_shot Fluffy_Pillow 23.5/100: 24% focus
2:30.720 arcane_shot Fluffy_Pillow 31.5/100: 32% focus
2:31.723 explosive_shot Fluffy_Pillow 20.1/100: 20% focus
2:32.729 cobra_shot Fluffy_Pillow 9.7/100: 10% focus
2:34.481 cobra_shot Fluffy_Pillow 17.8/100: 18% focus
2:36.232 cobra_shot Fluffy_Pillow 39.8/100: 40% focus
2:37.982 explosive_shot Fluffy_Pillow 61.8/100: 62% focus
2:38.986 cobra_shot Fluffy_Pillow 65.4/100: 65% focus
2:40.739 cobra_shot Fluffy_Pillow 73.4/100: 73% focus
2:42.491 barrage Fluffy_Pillow 95.4/100: 95% focus
2:45.261 explosive_shot Fluffy_Pillow 62.1/100: 62% focus lock_and_load(2)
2:46.265 explosive_shot Fluffy_Pillow 66.7/100: 67% focus lock_and_load, megawatt_filament
2:47.269 explosive_shot Fluffy_Pillow 71.3/100: 71% focus megawatt_filament
2:48.274 arcane_shot Fluffy_Pillow 60.9/100: 61% focus megawatt_filament
2:49.279 cobra_shot Fluffy_Pillow 35.5/100: 35% focus megawatt_filament
2:51.031 cobra_shot Fluffy_Pillow 43.5/100: 43% focus megawatt_filament
2:52.783 black_arrow Fluffy_Pillow 65.5/100: 66% focus megawatt_filament
2:53.787 explosive_shot Fluffy_Pillow 49.1/100: 49% focus megawatt_filament
2:54.793 cobra_shot Fluffy_Pillow 38.7/100: 39% focus megawatt_filament
2:56.547 cobra_shot Fluffy_Pillow 46.7/100: 47% focus megawatt_filament
2:58.301 cobra_shot Fluffy_Pillow 68.8/100: 69% focus
3:00.054 explosive_shot Fluffy_Pillow 90.8/100: 91% focus lock_and_load(2)
3:01.058 explosive_shot Fluffy_Pillow 100.0/100: 100% focus lock_and_load
3:02.062 explosive_shot Fluffy_Pillow 100.0/100: 100% focus
3:03.065 arcane_shot Fluffy_Pillow 89.6/100: 90% focus thrill_of_the_hunt(3)
3:04.070 arcane_shot Fluffy_Pillow 84.2/100: 84% focus thrill_of_the_hunt(2)
3:05.075 arcane_shot Fluffy_Pillow 78.8/100: 79% focus thrill_of_the_hunt
3:06.080 barrage Fluffy_Pillow 73.4/100: 73% focus thrill_of_the_hunt(3)
3:09.045 explosive_shot Fluffy_Pillow 27.0/100: 27% focus thrill_of_the_hunt(3)
3:10.049 cobra_shot Fluffy_Pillow 16.5/100: 17% focus thrill_of_the_hunt(3)
3:11.803 cobra_shot Fluffy_Pillow 24.6/100: 25% focus thrill_of_the_hunt(3)
3:13.555 a_murder_of_crows Fluffy_Pillow 46.6/100: 47% focus thrill_of_the_hunt(3)
3:14.562 arcane_shot Fluffy_Pillow 35.2/100: 35% focus thrill_of_the_hunt(3)
3:15.568 explosive_shot Fluffy_Pillow 29.8/100: 30% focus thrill_of_the_hunt(2)
3:16.572 cobra_shot Fluffy_Pillow 19.4/100: 19% focus thrill_of_the_hunt(2)
3:18.322 cobra_shot Fluffy_Pillow 27.4/100: 27% focus thrill_of_the_hunt(2)
3:20.075 black_arrow Fluffy_Pillow 49.4/100: 49% focus thrill_of_the_hunt(2)
3:21.078 cobra_shot Fluffy_Pillow 33.0/100: 33% focus thrill_of_the_hunt(2)
3:22.830 explosive_shot Fluffy_Pillow 41.0/100: 41% focus thrill_of_the_hunt(2)
3:23.835 arcane_shot Fluffy_Pillow 44.6/100: 45% focus thrill_of_the_hunt(2)
3:24.841 cobra_shot Fluffy_Pillow 39.2/100: 39% focus
3:26.595 explosive_shot Fluffy_Pillow 47.3/100: 47% focus lock_and_load(2)
3:27.599 explosive_shot Fluffy_Pillow 65.9/100: 66% focus lock_and_load(2)
3:28.603 explosive_shot Fluffy_Pillow 70.4/100: 70% focus lock_and_load
3:29.607 explosive_shot Fluffy_Pillow 75.0/100: 75% focus
3:30.611 barrage Fluffy_Pillow 64.6/100: 65% focus
3:33.446 cobra_shot Fluffy_Pillow 17.6/100: 18% focus
3:35.197 cobra_shot Fluffy_Pillow 25.6/100: 26% focus
3:36.950 explosive_shot Fluffy_Pillow 47.6/100: 48% focus
3:37.956 cobra_shot Fluffy_Pillow 51.2/100: 51% focus
3:39.707 cobra_shot Fluffy_Pillow 59.3/100: 59% focus
3:41.457 arcane_shot Fluffy_Pillow 81.3/100: 81% focus
3:42.462 cobra_shot Fluffy_Pillow 69.9/100: 70% focus
3:44.216 black_arrow Fluffy_Pillow 77.9/100: 78% focus
3:45.220 explosive_shot Fluffy_Pillow 61.5/100: 61% focus
3:46.225 cobra_shot Fluffy_Pillow 51.1/100: 51% focus
3:47.976 cobra_shot Fluffy_Pillow 59.1/100: 59% focus
3:49.729 arcane_shot Fluffy_Pillow 81.1/100: 81% focus
3:50.733 barrage Fluffy_Pillow 69.7/100: 70% focus
3:53.647 explosive_shot Fluffy_Pillow 23.0/100: 23% focus
3:54.652 cobra_shot Fluffy_Pillow 12.6/100: 13% focus
3:56.406 explosive_shot Fluffy_Pillow 20.7/100: 21% focus lock_and_load(2)
3:57.410 explosive_shot Fluffy_Pillow 39.3/100: 39% focus lock_and_load
3:58.414 explosive_shot Fluffy_Pillow 43.9/100: 44% focus
3:59.418 cobra_shot Fluffy_Pillow 33.5/100: 33% focus
4:01.172 cobra_shot Fluffy_Pillow 41.5/100: 41% focus
4:02.924 explosive_shot Fluffy_Pillow 63.5/100: 63% focus lock_and_load(2)
4:03.929 explosive_shot Fluffy_Pillow 82.1/100: 82% focus lock_and_load
4:04.934 explosive_shot Fluffy_Pillow 86.7/100: 87% focus
4:05.939 cobra_shot Fluffy_Pillow 76.3/100: 76% focus
4:07.692 arcane_shot Fluffy_Pillow 84.3/100: 84% focus
4:08.698 black_arrow Fluffy_Pillow 72.9/100: 73% focus thrill_of_the_hunt(2)
4:09.703 arcane_shot Fluffy_Pillow 42.5/100: 43% focus thrill_of_the_hunt(2)
4:10.710 arcane_shot Fluffy_Pillow 37.1/100: 37% focus thrill_of_the_hunt
4:11.714 explosive_shot Fluffy_Pillow 31.7/100: 32% focus
4:12.719 cobra_shot Fluffy_Pillow 21.3/100: 21% focus
4:14.471 cobra_shot Fluffy_Pillow 29.3/100: 29% focus
4:16.223 a_murder_of_crows Fluffy_Pillow 51.3/100: 51% focus
4:17.228 cobra_shot Fluffy_Pillow 39.9/100: 40% focus megawatt_filament
4:18.981 explosive_shot Fluffy_Pillow 48.0/100: 48% focus megawatt_filament
4:19.986 cobra_shot Fluffy_Pillow 51.6/100: 52% focus megawatt_filament
4:21.739 cobra_shot Fluffy_Pillow 59.6/100: 60% focus megawatt_filament
4:23.490 barrage Fluffy_Pillow 81.6/100: 82% focus megawatt_filament
4:26.363 explosive_shot Fluffy_Pillow 48.7/100: 49% focus megawatt_filament
4:27.367 cobra_shot Fluffy_Pillow 38.3/100: 38% focus megawatt_filament
4:29.120 arcane_shot Fluffy_Pillow 46.4/100: 46% focus megawatt_filament
4:30.123 potion Fluffy_Pillow 35.0/100: 35% focus lock_and_load(2)
4:30.123 explosive_shot Fluffy_Pillow 35.0/100: 35% focus lock_and_load(2), draenic_agility_potion
4:31.127 explosive_shot Fluffy_Pillow 39.5/100: 40% focus lock_and_load, draenic_agility_potion
4:32.132 explosive_shot Fluffy_Pillow 44.1/100: 44% focus draenic_agility_potion
4:33.136 cobra_shot Fluffy_Pillow 33.7/100: 34% focus draenic_agility_potion
4:34.888 black_arrow Fluffy_Pillow 41.8/100: 42% focus draenic_agility_potion
4:35.893 cobra_shot Fluffy_Pillow 25.4/100: 25% focus draenic_agility_potion
4:37.645 cobra_shot Fluffy_Pillow 33.4/100: 33% focus draenic_agility_potion
4:39.398 explosive_shot Fluffy_Pillow 55.4/100: 55% focus draenic_agility_potion
4:40.404 cobra_shot Fluffy_Pillow 59.0/100: 59% focus draenic_agility_potion
4:42.156 cobra_shot Fluffy_Pillow 67.0/100: 67% focus megawatt_filament, draenic_agility_potion
4:43.909 arcane_shot Fluffy_Pillow 89.0/100: 89% focus megawatt_filament, draenic_agility_potion
4:44.913 barrage Fluffy_Pillow 77.6/100: 78% focus megawatt_filament, draenic_agility_potion
4:47.749 explosive_shot Fluffy_Pillow 30.6/100: 31% focus megawatt_filament, draenic_agility_potion
4:48.754 cobra_shot Fluffy_Pillow 20.2/100: 20% focus megawatt_filament, draenic_agility_potion
4:50.506 cobra_shot Fluffy_Pillow 28.2/100: 28% focus megawatt_filament, draenic_agility_potion
4:52.260 arcane_shot Fluffy_Pillow 50.2/100: 50% focus megawatt_filament, draenic_agility_potion
4:53.266 arcane_shot Fluffy_Pillow 38.9/100: 39% focus megawatt_filament, draenic_agility_potion
4:54.271 explosive_shot Fluffy_Pillow 13.5/100: 13% focus lock_and_load(2), draenic_agility_potion
4:55.276 explosive_shot Fluffy_Pillow 18.0/100: 18% focus lock_and_load

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 926 882 882
Agility 4391 3920 3798 (1378)
Stamina 4422 4020 4020
Intellect 896 854 854
Spirit 711 711 711
Health 265320 241200 0
Focus 100 100 0
Crit 33.97% 28.06% 1437
Haste 14.40% 8.95% 787
Multistrike 13.97% 8.97% 592
Damage / Heal Versatility 4.98% 1.98% 258
Attack Power 4830 3920 0
Mastery 15.27% 10.27% 250
Armor 1224 1224 1224

Talents

Level
15 Posthaste Narrow Escape Crouching Tiger, Hidden Chimaera
30 Binding Shot Wyvern Sting Intimidation
45 Exhilaration Iron Hawk Spirit Bond
60 Steady Focus Dire Beast Thrill of the Hunt
75 A Murder of Crows Blink Strikes Stampede
90 Glaive Toss Powershot Barrage
100 Exotic Munitions Focusing Shot (Survival Hunter) Lone Wolf

Profile

hunter="Rapáx"
origin="http://eu.battle.net/wow/en/character/forscherliga/Rapáx/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/202/480970-avatar.jpg"
level=100
race=night_elf
role=attack
position=ranged_back
professions=skinning=700/leatherworking=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Yb!2022020
glyphs=liberation/deterrence/animal_bond/aspect_of_the_pack/aspect_of_the_cheetah/tame_beast
spec=survival

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_agility_flask
actions.precombat+=/food,type=blackrock_barbecue
actions.precombat+=/summon_pet
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/exotic_munitions,ammo_type=poisoned,if=active_enemies<3
actions.precombat+=/exotic_munitions,ammo_type=incendiary,if=active_enemies>=3
actions.precombat+=/potion,name=draenic_agility

# Executed every time the actor is available.

actions=auto_shot
actions+=/arcane_torrent,if=focus.deficit>=30
actions+=/blood_fury
actions+=/berserking
actions+=/potion,name=draenic_agility,if=(((cooldown.stampede.remains<1)&(cooldown.a_murder_of_crows.remains<1))&(trinket.stat.any.up|buff.archmages_greater_incandescence_agi.up))|target.time_to_die<=25
actions+=/call_action_list,name=aoe,if=active_enemies>1
actions+=/stampede,if=buff.potion.up|(cooldown.potion.remains&(buff.archmages_greater_incandescence_agi.up|trinket.stat.any.up))|target.time_to_die<=25
actions+=/black_arrow,if=!ticking
actions+=/explosive_shot
actions+=/a_murder_of_crows
actions+=/dire_beast
actions+=/arcane_shot,if=buff.thrill_of_the_hunt.react&focus>35&cast_regen<=focus.deficit|dot.serpent_sting.remains<=3|target.time_to_die<4.5
actions+=/glaive_toss
actions+=/powershot
actions+=/barrage
# Cast a second shot for steady focus if that won't cap us.
actions+=/cobra_shot,if=buff.pre_steady_focus.up&buff.steady_focus.remains<5&(14+cast_regen)<=focus.deficit<80
actions+=/arcane_shot,if=focus>=80|talent.focusing_shot.enabled
actions+=/focusing_shot
actions+=/cobra_shot

actions.aoe=stampede,if=buff.potion.up|(cooldown.potion.remains&(buff.archmages_greater_incandescence_agi.up|trinket.stat.any.up|buff.archmages_incandescence_agi.up))
actions.aoe+=/explosive_shot,if=buff.lock_and_load.react&(!talent.barrage.enabled|cooldown.barrage.remains>0)
actions.aoe+=/barrage
actions.aoe+=/black_arrow,if=!ticking
actions.aoe+=/explosive_shot,if=active_enemies<5
actions.aoe+=/explosive_trap,if=dot.explosive_trap.remains<=5
actions.aoe+=/a_murder_of_crows
actions.aoe+=/dire_beast
actions.aoe+=/multishot,if=buff.thrill_of_the_hunt.react&focus>50&cast_regen<=focus.deficit|dot.serpent_sting.remains<=5|target.time_to_die<4.5
actions.aoe+=/glaive_toss
actions.aoe+=/powershot
actions.aoe+=/cobra_shot,if=buff.pre_steady_focus.up&buff.steady_focus.remains<5&focus+14+cast_regen<80
actions.aoe+=/multishot,if=focus>=70|talent.focusing_shot.enabled
actions.aoe+=/focusing_shot
actions.aoe+=/cobra_shot

head=hood_of_dispassionate_execution,id=113608,bonus_id=566
neck=flechetteriddled_chain,id=113647,bonus_id=566,enchant=75crit
shoulders=gruntslayer_shoulderguards,id=115414
back=cloak_of_creeping_necrosis,id=113657,enchant=gift_of_critical_strike
chest=crackleproof_chestguard,id=116029
shirt=artisan_officers_shirt,id=89195
wrists=bracers_of_the_crying_chorus,id=113826,bonus_id=40
hands=grips_of_vicious_mauling,id=113593
waist=belt_of_imminent_lies,id=113827,bonus_id=566
legs=wayfaring_leggings,id=116189,bonus_id=83/526/536
feet=wayfaring_boots,id=116193,bonus_id=131/525/535
finger1=ceds_chiming_circle,id=109760,bonus_id=524,enchant=30crit
finger2=timeless_solium_band_of_the_assassin,id=118297,enchant=30crit
trinket1=grandiose_plans,id=114549
trinket2=bloodmaws_tooth,id=116289
main_hand=crystalline_branch_of_the_brackenspore,id=113652,enchant=megawatt_filament

# Gear Summary
# gear_agility=2446
# gear_stamina=3130
# gear_crit_rating=1437
# gear_haste_rating=787
# gear_mastery_rating=250
# gear_armor=1224
# gear_multistrike_rating=564
# gear_versatility_rating=258
# gear_avoidance_rating=68
summon_pet=cat

Rosalîîe

Rosalîîe : 25977 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
25977.0 25977.0 7.2 / 0.028% 2277.4 / 8.8% 2708.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
9.2 9.2 Focus 0.00% 44.5 100.0% 100%
Origin http://eu.battle.net/wow/en/character/die-nachtwache/Rosalîîe/advanced
Talents
  • 15: Posthaste
  • 30: Binding Shot
  • 45: Iron Hawk
  • 60: Dire Beast
  • 75: A Murder of Crows
  • 90: Barrage
  • 100: Lone Wolf
  • Talent Calculator
Glyphs
  • Glyph of Deterrence
  • Glyph of Black Ice
  • Glyph of Liberation
  • Glyph of Aspect of the Cheetah
Professions
  • engineering: 700
  • enchanting: 700

Charts

http://2.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Rosal%C3%AE%C3%AEe+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x270&chd=t:95822|90750|29739|27924|24247|16825|5962|3151&chds=0,191644&chco=C79C6E,9482C9,C79C6E,C41F3B,C79C6E,69CCF0,ABD473,C79C6E&chm=t++95822++a_murder_of_crows,C79C6E,0,0,15|t++90750++black_arrow,9482C9,1,0,15|t++29739++dire_beast,C79C6E,2,0,15|t++27924++explosive_shot,C41F3B,3,0,15|t++24247++barrage,C79C6E,4,0,15|t++16825++arcane_shot,69CCF0,5,0,15|t++5962++cobra_shot,ABD473,6,0,15|t++3151++auto_shot,C79C6E,7,0,15& http://3.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Rosal%C3%AE%C3%AEe+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:28,15,12,11,11,11,7,6,4&chds=0,100&chdls=ffffff&chco=C41F3B,9482C9,C79C6E,ABD473,C79C6E,ABD473,C79C6E,69CCF0,C79C6E&chl=explosive_shot|black_arrow|barrage|serpent_sting|auto_shot|cobra_shot|crow_peck|arcane_shot|dire_beast_1: dire_beast_melee&
http://5.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Rosal%C3%AE%C3%AEe+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:Zdgkosuy0447787331yyxvtqqppmnmmmnmmooppnonnnljjiiiihihiijijllnoopppppopppppponnmmllmlmlkkjiihhhghhhhhhiiiiijjjkjkkjjjjjijjijjkllnnooopqqqqpqpoonmmkkjiihhhhhhhiijjjkjjjjjjiiiiiiiiiiijjkllmnnnooooooooononmnmmmlllklkkkjjiiihhihiiiiiijjkkklkklkkkkkkjkkkklmmnoopppqqqqpppoonmmkkjjjiiiijjjkjkkkkkkkkjkjjjjjjjkjkkkllmnnoooooopoooopoooooononnnmmmlllkkkkkjkkkkklllmmnnnnmmmkigdbZXVTR&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.642322,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=25977|max=40442&chxp=1,1,64,100 http://8.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Rosal%C3%AE%C3%AEe+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:3,7,8,18,47,66,138,216,380,510,655,876,1115,1220,1499,1608,1741,1765,1713,1681,1602,1421,1298,1165,935,761,632,507,354,258,210,166,128,94,68,42,23,22,22,7,3,10,2,1,0,1,0,1,0,1&chds=0,1765&chbh=5&chxt=x&chxl=0:|min=24087|avg=25977|max=29151&chxp=0,1,37,100& http://4.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Rosal%C3%AE%C3%AEe+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:45.8,24.8,11.9,8.2,4.2,3.3,1.8&chds=0,100&chdls=ffffff&chco=ABD473,C41F3B,C79C6E,69CCF0,9482C9,C79C6E,C79C6E&chl=cobra_shot 137.8s|explosive_shot 74.7s|barrage 35.8s|arcane_shot 24.6s|black_arrow 12.6s|dire_beast 10.0s|a_murder_of_crows 5.3s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Rosalîîe 25977
a_murder_of_crows 0 (1695) 0.0% (6.5%) 5.3 62.13sec 96241 95822

Stats details: a_murder_of_crows

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.29 5.29 77.49 77.49 1.0045 1.0000 0.00 0.00 0.00 6148.21 95822.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.29 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.5 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: a_murder_of_crows

Static Values
  • id:131894
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131894
  • name:A Murder of Crows
  • school:physical
  • tooltip:Under attack by a flock of crows.
  • description:Summons a flock of crows to attack your target over the next {$d=15 seconds}. If the target dies while under attack, A Murder of Crows' cooldown is reset.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
 
    crow_peck 1695 6.5% 0.0 0.00sec 0 0 Direct 77.5 4456 8912 5749 29.0% 36.2 1363 2726 29.1%  

Stats details: crow_peck

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 77.49 0.00 0.00 0.0000 0.0000 509102.87 782410.73 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 10.51 29.06% 2726.15 2475 3065 2726.97 0 3065 28646 44025 34.93
multistrike 25.65 70.94% 1362.55 1237 1532 1363.15 1237 1532 34948 53709 34.93
hit 55.00 70.98% 4455.85 4124 5108 4459.53 4205 4771 245081 376651 34.93
crit 22.49 29.02% 8911.78 8249 10216 8919.18 8249 9935 200427 308025 34.93
 
DPS Timeline Chart
 

Action details: crow_peck

Static Values
  • id:131900
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131900
  • name:A Murder of Crows
  • school:physical
  • tooltip:
  • description:Deals {$s1=1} physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.170000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
arcane_shot 1381 5.3% 24.5 12.46sec 16900 16825 Direct 24.3 11348 22699 14645 29.0% 11.0 4112 8224 28.9%  

Stats details: arcane_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.52 24.31 0.00 0.00 1.0045 0.0000 414399.17 414399.17 0.00 16824.98 16824.98
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.18 28.91% 8224.33 7935 9367 7885.26 0 9367 26183 26183 0.00
multistrike 7.83 71.09% 4111.86 3967 4684 4113.33 0 4684 32187 32187 0.00
hit 17.25 70.96% 11348.34 11021 13010 11352.85 11021 12015 195763 195763 0.00
crit 7.06 29.04% 22699.21 22041 26020 22695.83 0 26020 160266 160266 0.00
 
DPS Timeline Chart
 

Action details: arcane_shot

Static Values
  • id:3044
  • school:arcane
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.000
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.thrill_of_the_hunt.react&focus>35&cast_regen<=focus.deficit|dot.serpent_sting.remains<=3|target.time_to_die<4.5
Spelldata
  • id:3044
  • name:Arcane Shot
  • school:arcane
  • tooltip:
  • description:An instant shot that causes $sw2 Arcane damage.$?p131564[ Grants {$142978s1=122} PvP Power for {$142978d=6 seconds}.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.26
 
auto_shot 2741 10.5% 104.5 2.89sec 7885 3151 Direct 104.5 5260 10521 6786 29.0% 46.6 1910 3819 29.0%  

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 104.46 104.46 0.00 0.00 2.5022 0.0000 823650.91 1265821.40 34.93 3151.09 3151.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 13.53 29.04% 3818.85 3676 4351 3820.67 3676 4351 51673 79414 34.93
multistrike 33.06 70.96% 1909.52 1838 2175 1910.46 1838 2038 63132 97024 34.93
hit 74.17 71.00% 5260.10 5106 6042 5262.47 5167 5412 390144 599590 34.93
crit 30.29 29.00% 10520.81 10211 12085 10525.47 10211 11099 318702 489794 34.93
 
DPS Timeline Chart
 

Action details: auto_shot

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
barrage 2886 11.1% 12.9 23.14sec 67390 24247 Periodic 205.6 2641 5282 3407 29.0% 88.6 1467 2934 29.0% 10.8%

Stats details: barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.88 12.88 206.13 205.60 2.7793 0.1581 868172.14 1244253.24 30.23 24247.23 24247.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.88 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 25.7 29.00% 2934.00 2845 3358 2935.22 2845 3221 75375 75375 0.00
multistrike 62.9 71.00% 1467.02 1422 1679 1467.64 1422 1574 92254 92254 0.00
hit 145.9 70.98% 2640.92 2571 3035 2642.08 2586 2722 385419 592327 34.93
crit 59.7 29.02% 5281.87 5142 6070 5284.09 5142 5557 315125 484297 34.93
 
DPS Timeline Chart
 

Action details: barrage

Static Values
  • id:120360
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120360
  • name:Barrage
  • school:physical
  • tooltip:
  • description:Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the enemy target and an average of $<damageSec> Physical damage to each other enemy target in front of you. Usable while moving.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: barrage_primary

Static Values
  • id:120361
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120361
  • name:Barrage
  • school:physical
  • tooltip:
  • description:{$@spelldesc120360=Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the enemy target and an average of $<damageSec> Physical damage to each other enemy target in front of you. Usable while moving.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.69
 
black_arrow 3801 14.6% 12.5 24.91sec 91152 90750 Periodic 121.1 6298 12595 8126 29.0% 53.8 2289 4578 29.0% 80.5%

Stats details: black_arrow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.54 12.52 121.09 121.09 1.0045 2.0000 1142994.68 1142994.68 0.00 4486.36 90749.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.88 70.89% 0.00 0 0 0.00 0 0 0 0 0.00
crit 3.64 29.11% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 15.6 29.03% 4577.97 4373 5416 4581.07 4373 5416 71553 71553 0.00
multistrike 38.2 70.97% 2288.90 2186 2708 2290.47 2186 2484 87457 87457 0.00
hit 85.9 70.97% 6298.20 6073 7522 6302.00 6156 6487 541220 541220 0.00
crit 35.2 29.03% 12594.54 12147 15043 12601.99 12147 13484 442765 442765 0.00
 
DPS Timeline Chart
 

Action details: black_arrow

Static Values
  • id:3674
  • school:shadow
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:24.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:3674
  • name:Black Arrow
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1 seconds.
  • description:Fires a Black Arrow at the target, dealing $3674o1 damage over {$3674d=20 seconds}. Your Black Arrow periodic damage has a {$s2=20}% chance to trigger Lock and Load, causing your next two Explosive Shots to cost no Focus and trigger no cooldown. When Black Arrow is dispelled, its cooldown is reset.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.566720
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
cobra_shot 2731 10.5% 81.4 3.62sec 10096 5962 Direct 81.1 6776 13553 8743 29.0% 35.3 2453 4907 29.0%  

Stats details: cobra_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.35 81.14 0.00 0.00 1.6934 0.0000 821294.03 821294.03 0.00 5961.99 5961.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 10.24 29.00% 4906.55 4761 5620 4908.08 0 5620 50265 50265 0.00
multistrike 25.09 71.00% 2453.15 2380 2810 2454.24 2380 2659 61542 61542 0.00
hit 57.59 70.97% 6776.22 6612 7806 6778.85 6632 6991 390225 390225 0.00
crit 23.56 29.03% 13552.78 13225 15612 13557.80 13225 14481 319262 319262 0.00
 
DPS Timeline Chart
 

Action details: cobra_shot

Static Values
  • id:77767
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.pre_steady_focus.up&buff.steady_focus.remains<5&(14+cast_regen)<=focus.deficit<80
Spelldata
  • id:77767
  • name:Cobra Shot
  • school:nature
  • tooltip:
  • description:Deals $sw2 Nature damage and generates {$91954s1=14} Focus. Usable while moving.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.76
 
dire_beast 0 (986) 0.0% (3.8%) 9.9 31.66sec 29871 29739

Stats details: dire_beast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.91 9.91 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 29738.98 29738.98
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.91 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: dire_beast

Static Values
  • id:120679
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:120679
  • name:Dire Beast
  • school:nature
  • tooltip:
  • description:Summons a powerful wild beast to attack your target for {$d=15 seconds}. Each time the beast deals damage, you will gain {$120694s1=2} Focus.
 
    dire_beast_melee (dire_beast_1) 2163 3.8% 82.7 3.57sec 3581 2141 Direct 82.7 2435 4871 3140 29.0% 38.1 741 1481 29.1%  

Stats details: dire_beast_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.66 82.66 0.00 0.00 1.6728 0.0000 295992.08 454893.09 34.93 2140.53 2140.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 11.08 29.12% 1481.06 1390 1721 1482.03 0 1721 16416 25228 34.93
multistrike 26.97 70.88% 740.56 695 861 741.12 695 827 19976 30700 34.93
hit 58.72 71.04% 2435.04 2316 2868 2436.70 2348 2537 142995 219760 34.93
crit 23.94 28.96% 4870.99 4632 5737 4874.22 4632 5461 116606 179205 34.93
 
DPS Timeline Chart
 

Action details: dire_beast_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
explosive_shot 6939 26.7% 74.4 4.04sec 28049 27924 Direct 74.2 4725 9450 6097 29.0% 33.2 1718 3435 28.9%  
Periodic 167.9 6205 12409 8006 29.0% 74.7 2244 4487 29.1% 55.8%

Stats details: explosive_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.39 74.17 167.93 167.93 1.0045 1.0000 2086698.94 2086698.94 0.00 8599.27 27923.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 9.60 28.89% 3434.69 3280 4062 3436.44 0 4062 32971 32971 0.00
multistrike 23.63 71.11% 1717.66 1640 2031 1718.77 1640 1933 40581 40581 0.00
hit 52.64 70.97% 4725.05 4555 5641 4727.91 4579 4959 248709 248709 0.00
crit 21.53 29.03% 9449.82 9110 11282 9455.22 9110 10368 203463 203463 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 21.7 29.06% 4486.65 3280 11827 4484.35 3280 6245 97464 97464 0.00
multistrike 53.0 70.94% 2244.27 1640 5943 2243.23 1818 2878 118994 118994 0.00
hit 119.2 70.96% 6204.53 4555 16426 6204.33 5569 7556 739358 739358 0.00
crit 48.8 29.04% 12409.40 9110 33014 12408.21 10389 15952 605158 605158 0.00
 
DPS Timeline Chart
 

Action details: explosive_shot

Static Values
  • id:53301
  • school:fire
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53301
  • name:Explosive Shot
  • school:fire
  • tooltip:Taking Fire damage every second.
  • description:You fire an explosive charge into the enemy target, dealing ${$<explosive>} Fire damage initially and every second for {$d=2 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.552552
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 

Action details: explosive_shot_tick

Static Values
  • id:53301
  • school:fire
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53301
  • name:Explosive Shot
  • school:fire
  • tooltip:Taking Fire damage every second.
  • description:You fire an explosive charge into the enemy target, dealing ${$<explosive>} Fire damage initially and every second for {$d=2 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:3.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
serpent_sting 2818 10.9% 24.3 12.52sec 34855 0 Periodic 120.6 4691 9378 6053 29.0% 53.0 1719 3438 29.0% 96.0%

Stats details: serpent_sting

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.31 24.31 120.57 120.57 0.0000 2.3951 847359.27 847359.27 0.00 2934.25 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.28 71.10% 0.00 0 0 0.00 0 0 0 0 0.00
crit 7.03 28.90% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 15.4 28.97% 3438.15 3311 4101 3440.32 3311 3903 52833 52833 0.00
multistrike 37.7 71.03% 1719.06 1655 2050 1720.15 1655 1861 64763 64763 0.00
hit 85.5 70.95% 4690.95 2 5695 4693.46 4478 4889 401291 401291 0.00
crit 35.0 29.05% 9378.01 3 11390 9383.10 8264 10094 328472 328472 0.00
 
DPS Timeline Chart
 

Action details: serpent_sting

Static Values
  • id:118253
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118253
  • name:Serpent Sting
  • school:nature
  • tooltip:Causes $w1 Nature damage every $t1 seconds.
  • description:Causes $o1 Nature damage over {$d=15 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.725402
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - dire_beast_1 2163 / 986
dire_beast_melee 2163 3.8% 82.7 3.57sec 3581 2141 Direct 82.7 2435 4871 3140 29.0% 38.1 741 1481 29.1%  

Stats details: dire_beast_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.66 82.66 0.00 0.00 1.6728 0.0000 295992.08 454893.09 34.93 2140.53 2140.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 11.08 29.12% 1481.06 1390 1721 1482.03 0 1721 16416 25228 34.93
multistrike 26.97 70.88% 740.56 695 861 741.12 695 827 19976 30700 34.93
hit 58.72 71.04% 2435.04 2316 2868 2436.70 2348 2537 142995 219760 34.93
crit 23.94 28.96% 4870.99 4632 5737 4874.22 4632 5461 116606 179205 34.93
 
DPS Timeline Chart
 

Action details: dire_beast_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Simple Action Stats Execute Interval
Rosalîîe
draenic_agility_potion 2.0 0.00sec

Stats details: draenic_agility_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156423
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156423
  • name:Draenic Agility Potion
  • school:physical
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
balanced_fate 5.7 0.0 50.9sec 50.4sec 18.67% 18.68% 0.0(0.0)

Buff details

  • buff initial source:Rosalîîe
  • cooldown name:buff_balanced_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:multistrike_rating
  • amount:2004.00

Stack Uptimes

  • balanced_fate_1:18.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:177038
  • name:Balanced Fate
  • tooltip:Increases Multistrike by {$s1=1135}.
  • description:Increases Multistrike by {$s1=1135} for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 42.86% 0.0(0.0)

Buff details

  • buff initial source:Rosalîîe
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
draenic_agility_potion 2.0 0.0 191.2sec 0.0sec 15.04% 15.05% 0.0(0.0)

Buff details

  • buff initial source:Rosalîîe
  • cooldown name:buff_draenic_agility_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:1000.00

Stack Uptimes

  • draenic_agility_potion_1:15.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156423
  • name:Draenic Agility Potion
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
lock_and_load 14.9 0.2 20.0sec 19.6sec 9.08% 40.02% 0.2(0.3)

Buff details

  • buff initial source:Rosalîîe
  • cooldown name:buff_lock_and_load
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • lock_and_load_1:5.00%
  • lock_and_load_2:4.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:168980
  • name:Lock and Load
  • tooltip:Your Explosive Shot triggers no cooldown.
  • description:{$@spelldesc3674=Fires a Black Arrow at the target, dealing $3674o1 damage over {$3674d=20 seconds}. Your Black Arrow periodic damage has a {$s2=20}% chance to trigger Lock and Load, causing your next two Explosive Shots to cost no Focus and trigger no cooldown. When Black Arrow is dispelled, its cooldown is reset.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
oglethorpes_missile_splitter 7.2 2.4 43.8sec 31.5sec 32.82% 32.83% 2.4(2.4)

Buff details

  • buff initial source:Rosalîîe
  • cooldown name:buff_oglethorpes_missile_splitter
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:multistrike_rating
  • amount:750.00

Stack Uptimes

  • oglethorpes_missile_splitter_1:32.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156055
  • name:Oglethorpe's Missile Splitter
  • tooltip:Multistrike increased by $w1.
  • description:Multistrike increased by {$s1=750}.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_agility_flask

Buff details

  • buff initial source:Rosalîîe
  • cooldown name:buff_greater_draenic_agility_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:250.00

Stack Uptimes

  • greater_draenic_agility_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156064
  • name:Greater Draenic Agility Flask
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Rosalîîe
a_murder_of_crows Focus 5.3 158.7 30.0 30.0 3208.1
arcane_shot Focus 24.5 735.6 30.0 30.0 563.3
barrage Focus 12.9 773.0 60.0 60.0 1123.2
black_arrow Focus 12.5 438.9 35.0 35.0 2604.3
explosive_shot Focus 74.4 667.8 9.0 9.0 3124.9
Resource Gains Type Count Total Average Overflow
focus_regen Focus 220.36 1403.82 (52.07%) 6.37 24.13 1.69%
external_healing Health 7.99 0.00 (0.00%) 0.00 75245.53 100.00%
cobra_shot Focus 81.14 1127.73 (41.83%) 13.90 8.29 0.73%
dire_beast Focus 82.66 164.29 (6.09%) 1.99 1.03 0.63%
Resource RPS-Gain RPS-Loss
Focus 8.96 9.22
Combat End Resource Mean Min Max
Focus 21.80 0.02 100.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Focus Cap 0.8%
cat-Focus Cap 0.8%
devilsaur-Focus Cap 0.8%
raptor-Focus Cap 0.8%
hyena-Focus Cap 0.8%
wolf-Focus Cap 0.8%
wasp-Focus Cap 0.8%
t17_pet_2-Focus Cap 0.8%
t17_pet_1-Focus Cap 0.8%
dire_beast_1-Focus Cap 0.8%
dire_beast_2-Focus Cap 0.8%
tier15_thunderhawk-Focus Cap 0.8%
tier15_thunderhawk-Focus Cap 0.8%
tier15_thunderhawk-Focus Cap 0.8%
tier15_thunderhawk-Focus Cap 0.8%
tier15_thunderhawk-Focus Cap 0.8%
tier15_thunderhawk-Focus Cap 0.8%
tier15_thunderhawk-Focus Cap 0.8%
tier15_thunderhawk-Focus Cap 0.8%
tier15_thunderhawk-Focus Cap 0.8%
tier15_thunderhawk-Focus Cap 0.8%

Procs

Count Interval
starved: black_arrow 1.4 18.8sec
starved: explosive_shot 0.5 50.9sec
starved: a_murder_of_crows 1.2 23.6sec
starved: barrage 9.3 30.4sec
lock_and_load 15.1 19.6sec

Statistics & Data Analysis

Fight Length
Sample Data Rosalîîe Fight Length
Count 25000
Mean 300.94
Minimum 230.43
Maximum 374.11
Spread ( max - min ) 143.68
Range [ ( max - min ) / 2 * 100% ] 23.87%
DPS
Sample Data Rosalîîe Damage Per Second
Count 25000
Mean 25977.00
Minimum 24087.40
Maximum 29151.37
Spread ( max - min ) 5063.97
Range [ ( max - min ) / 2 * 100% ] 9.75%
Standard Deviation 579.0715
5th Percentile 25071.86
95th Percentile 26964.55
( 95th Percentile - 5th Percentile ) 1892.68
Mean Distribution
Standard Deviation 3.6624
95.00% Confidence Intervall ( 25969.82 - 25984.17 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1908
0.1 Scale Factor Error with Delta=300 2862
0.05 Scale Factor Error with Delta=300 11450
0.01 Scale Factor Error with Delta=300 286251
Distribution Chart
DPS(e)
Sample Data Rosalîîe Damage Per Second (Effective)
Count 25000
Mean 25977.00
Minimum 24087.40
Maximum 29151.37
Spread ( max - min ) 5063.97
Range [ ( max - min ) / 2 * 100% ] 9.75%
Damage
Sample Data Rosalîîe Damage
Count 25000
Mean 7513672.02
Minimum 5546674.28
Maximum 9670685.75
Spread ( max - min ) 4124011.47
Range [ ( max - min ) / 2 * 100% ] 27.44%
DTPS
Sample Data Rosalîîe Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Rosalîîe Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Rosalîîe Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Rosalîîe Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Rosalîîe Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Rosalîîe Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data RosalîîeTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Rosalîîe Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_agility_flask
1 0.00 food,type=blackrock_barbecue
2 0.00 summon_pet
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 exotic_munitions,ammo_type=poisoned,if=active_enemies<3
5 0.00 exotic_munitions,ammo_type=incendiary,if=active_enemies>=3
6 0.00 potion,name=draenic_agility
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 auto_shot
8 0.00 arcane_torrent,if=focus.deficit>=30
9 0.00 blood_fury
A 0.00 berserking
B 1.00 potion,name=draenic_agility,if=(((cooldown.stampede.remains<1)&(cooldown.a_murder_of_crows.remains<1))&(trinket.stat.any.up|buff.archmages_greater_incandescence_agi.up))|target.time_to_die<=25
C 0.00 call_action_list,name=aoe,if=active_enemies>1
D 0.00 stampede,if=buff.potion.up|(cooldown.potion.remains&(buff.archmages_greater_incandescence_agi.up|trinket.stat.any.up))|target.time_to_die<=25
E 12.54 black_arrow,if=!ticking
F 74.40 explosive_shot
G 5.29 a_murder_of_crows
H 9.91 dire_beast
I 14.97 arcane_shot,if=buff.thrill_of_the_hunt.react&focus>35&cast_regen<=focus.deficit|dot.serpent_sting.remains<=3|target.time_to_die<4.5
J 0.00 glaive_toss
K 0.00 powershot
L 12.88 barrage
M 0.00 cobra_shot,if=buff.pre_steady_focus.up&buff.steady_focus.remains<5&(14+cast_regen)<=focus.deficit<80
Cast a second shot for steady focus if that won't cap us.
N 9.55 arcane_shot,if=focus>=80|talent.focusing_shot.enabled
O 0.00 focusing_shot
P 81.82 cobra_shot

Sample Sequence

0167EFGHIPPFLPPFPPFFFIPPENFPPLPFHPPFFFNPPNFNEPPFPFFFLPGFHPIPFPEPPFLPIFPPFFFPPHIEFPPLFPPPFIPPFFFNEPGPFFFHPLFFFFIFFFPPEPFPPIPFLHPFPPFFFEIPPFPLPFGIPPFHFFFEPPFFFIPPLFPPFFFIPEHPFPPLFIFFFFFPPPFEGIPPFFFFFFHLPFFFIPBPEFPFFFPIPPFLHPFIIP

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 100.0/100: 100% focus
Pre food Fluffy_Pillow 100.0/100: 100% focus
Pre potion Fluffy_Pillow 100.0/100: 100% focus draenic_agility_potion
0:00.000 start_auto_shot Fluffy_Pillow 100.0/100: 100% focus draenic_agility_potion
0:00.000 black_arrow Fluffy_Pillow 100.0/100: 100% focus draenic_agility_potion
0:01.004 explosive_shot Fluffy_Pillow 71.0/100: 71% focus bloodlust, oglethorpes_missile_splitter, draenic_agility_potion
0:02.010 a_murder_of_crows Fluffy_Pillow 61.9/100: 62% focus bloodlust, oglethorpes_missile_splitter, draenic_agility_potion
0:03.016 dire_beast Fluffy_Pillow 37.9/100: 38% focus bloodlust, oglethorpes_missile_splitter, draenic_agility_potion
0:04.021 arcane_shot Fluffy_Pillow 45.9/100: 46% focus bloodlust, oglethorpes_missile_splitter, draenic_agility_potion
0:05.025 cobra_shot Fluffy_Pillow 23.9/100: 24% focus bloodlust, oglethorpes_missile_splitter, draenic_agility_potion
0:06.375 cobra_shot Fluffy_Pillow 33.9/100: 34% focus bloodlust, oglethorpes_missile_splitter, draenic_agility_potion
0:07.726 explosive_shot Fluffy_Pillow 57.9/100: 58% focus bloodlust, oglethorpes_missile_splitter, draenic_agility_potion
0:08.731 barrage Fluffy_Pillow 64.9/100: 65% focus bloodlust, oglethorpes_missile_splitter, draenic_agility_potion
0:11.025 cobra_shot Fluffy_Pillow 20.5/100: 21% focus bloodlust, balanced_fate, oglethorpes_missile_splitter, draenic_agility_potion
0:12.377 cobra_shot Fluffy_Pillow 30.5/100: 31% focus bloodlust, balanced_fate, oglethorpes_missile_splitter, draenic_agility_potion
0:13.728 explosive_shot Fluffy_Pillow 54.6/100: 55% focus bloodlust, balanced_fate, oglethorpes_missile_splitter, draenic_agility_potion
0:14.732 cobra_shot Fluffy_Pillow 61.5/100: 62% focus bloodlust, balanced_fate, oglethorpes_missile_splitter, draenic_agility_potion
0:16.081 cobra_shot Fluffy_Pillow 71.6/100: 72% focus bloodlust, balanced_fate, oglethorpes_missile_splitter, draenic_agility_potion
0:17.432 explosive_shot Fluffy_Pillow 93.6/100: 94% focus bloodlust, lock_and_load(2), balanced_fate, oglethorpes_missile_splitter, draenic_agility_potion
0:18.436 explosive_shot Fluffy_Pillow 100.0/100: 100% focus bloodlust, lock_and_load, balanced_fate, oglethorpes_missile_splitter, draenic_agility_potion
0:19.439 explosive_shot Fluffy_Pillow 100.0/100: 100% focus bloodlust, balanced_fate, oglethorpes_missile_splitter, draenic_agility_potion
0:20.443 arcane_shot Fluffy_Pillow 91.0/100: 91% focus bloodlust, balanced_fate
0:21.448 cobra_shot Fluffy_Pillow 66.9/100: 67% focus bloodlust
0:22.800 cobra_shot Fluffy_Pillow 75.0/100: 75% focus bloodlust
0:24.151 black_arrow Fluffy_Pillow 97.0/100: 97% focus bloodlust
0:25.154 arcane_shot Fluffy_Pillow 82.0/100: 82% focus bloodlust
0:26.158 explosive_shot Fluffy_Pillow 57.9/100: 58% focus bloodlust
0:27.162 cobra_shot Fluffy_Pillow 48.9/100: 49% focus bloodlust
0:28.513 cobra_shot Fluffy_Pillow 56.9/100: 57% focus bloodlust
0:29.863 barrage Fluffy_Pillow 78.9/100: 79% focus bloodlust
0:32.002 cobra_shot Fluffy_Pillow 45.7/100: 46% focus bloodlust
0:33.352 explosive_shot Fluffy_Pillow 53.7/100: 54% focus bloodlust
0:34.357 dire_beast Fluffy_Pillow 58.6/100: 59% focus bloodlust
0:35.362 cobra_shot Fluffy_Pillow 66.6/100: 67% focus bloodlust
0:36.713 cobra_shot Fluffy_Pillow 76.6/100: 77% focus bloodlust
0:38.064 explosive_shot Fluffy_Pillow 100.0/100: 100% focus bloodlust, lock_and_load(2)
0:39.068 explosive_shot Fluffy_Pillow 100.0/100: 100% focus bloodlust, lock_and_load
0:40.072 explosive_shot Fluffy_Pillow 100.0/100: 100% focus bloodlust
0:41.077 arcane_shot Fluffy_Pillow 89.6/100: 90% focus
0:42.082 cobra_shot Fluffy_Pillow 66.2/100: 66% focus
0:43.837 cobra_shot Fluffy_Pillow 76.2/100: 76% focus
0:45.589 arcane_shot Fluffy_Pillow 100.0/100: 100% focus
0:46.592 explosive_shot Fluffy_Pillow 90.6/100: 91% focus
0:47.597 arcane_shot Fluffy_Pillow 80.2/100: 80% focus
0:48.602 black_arrow Fluffy_Pillow 54.8/100: 55% focus
0:49.606 cobra_shot Fluffy_Pillow 24.4/100: 24% focus balanced_fate
0:51.362 cobra_shot Fluffy_Pillow 32.4/100: 32% focus balanced_fate
0:53.117 explosive_shot Fluffy_Pillow 54.4/100: 54% focus balanced_fate
0:54.122 cobra_shot Fluffy_Pillow 58.0/100: 58% focus balanced_fate
0:55.876 explosive_shot Fluffy_Pillow 66.0/100: 66% focus lock_and_load(2), balanced_fate
0:56.880 explosive_shot Fluffy_Pillow 84.6/100: 85% focus lock_and_load, balanced_fate
0:57.885 explosive_shot Fluffy_Pillow 89.2/100: 89% focus balanced_fate
0:58.888 barrage Fluffy_Pillow 78.8/100: 79% focus
1:01.775 cobra_shot Fluffy_Pillow 32.0/100: 32% focus
1:03.530 a_murder_of_crows Fluffy_Pillow 40.0/100: 40% focus
1:04.535 explosive_shot Fluffy_Pillow 28.6/100: 29% focus
1:05.538 dire_beast Fluffy_Pillow 18.2/100: 18% focus
1:06.542 cobra_shot Fluffy_Pillow 24.8/100: 25% focus
1:08.297 arcane_shot Fluffy_Pillow 34.8/100: 35% focus
1:09.301 cobra_shot Fluffy_Pillow 25.4/100: 25% focus
1:11.056 explosive_shot Fluffy_Pillow 35.4/100: 35% focus balanced_fate
1:12.061 cobra_shot Fluffy_Pillow 39.0/100: 39% focus balanced_fate
1:13.816 black_arrow Fluffy_Pillow 49.0/100: 49% focus balanced_fate
1:14.821 cobra_shot Fluffy_Pillow 34.6/100: 35% focus balanced_fate
1:16.575 cobra_shot Fluffy_Pillow 44.6/100: 45% focus balanced_fate
1:18.329 explosive_shot Fluffy_Pillow 68.6/100: 69% focus balanced_fate, oglethorpes_missile_splitter
1:19.335 barrage Fluffy_Pillow 72.2/100: 72% focus balanced_fate, oglethorpes_missile_splitter
1:22.280 cobra_shot Fluffy_Pillow 25.7/100: 26% focus oglethorpes_missile_splitter
1:24.034 arcane_shot Fluffy_Pillow 33.7/100: 34% focus oglethorpes_missile_splitter
1:25.038 explosive_shot Fluffy_Pillow 22.3/100: 22% focus oglethorpes_missile_splitter
1:26.042 cobra_shot Fluffy_Pillow 11.9/100: 12% focus oglethorpes_missile_splitter
1:27.795 cobra_shot Fluffy_Pillow 19.9/100: 20% focus oglethorpes_missile_splitter
1:29.551 explosive_shot Fluffy_Pillow 41.9/100: 42% focus lock_and_load(2), oglethorpes_missile_splitter
1:30.556 explosive_shot Fluffy_Pillow 60.5/100: 61% focus lock_and_load
1:31.560 explosive_shot Fluffy_Pillow 65.1/100: 65% focus
1:32.565 cobra_shot Fluffy_Pillow 54.7/100: 55% focus
1:34.320 cobra_shot Fluffy_Pillow 62.7/100: 63% focus
1:36.074 dire_beast Fluffy_Pillow 84.8/100: 85% focus oglethorpes_missile_splitter
1:37.079 arcane_shot Fluffy_Pillow 100.0/100: 100% focus oglethorpes_missile_splitter
1:38.082 black_arrow Fluffy_Pillow 76.6/100: 77% focus oglethorpes_missile_splitter
1:39.085 explosive_shot Fluffy_Pillow 46.2/100: 46% focus oglethorpes_missile_splitter
1:40.089 cobra_shot Fluffy_Pillow 37.8/100: 38% focus oglethorpes_missile_splitter
1:41.844 cobra_shot Fluffy_Pillow 47.8/100: 48% focus oglethorpes_missile_splitter
1:43.599 barrage Fluffy_Pillow 71.8/100: 72% focus oglethorpes_missile_splitter
1:46.455 explosive_shot Fluffy_Pillow 40.9/100: 41% focus oglethorpes_missile_splitter
1:47.460 cobra_shot Fluffy_Pillow 32.5/100: 32% focus oglethorpes_missile_splitter
1:49.214 cobra_shot Fluffy_Pillow 42.5/100: 42% focus
1:50.968 cobra_shot Fluffy_Pillow 64.5/100: 64% focus
1:52.722 explosive_shot Fluffy_Pillow 86.5/100: 87% focus
1:53.727 arcane_shot Fluffy_Pillow 90.1/100: 90% focus
1:54.733 cobra_shot Fluffy_Pillow 64.7/100: 65% focus
1:56.488 cobra_shot Fluffy_Pillow 72.7/100: 73% focus oglethorpes_missile_splitter
1:58.243 explosive_shot Fluffy_Pillow 94.7/100: 95% focus lock_and_load(2), oglethorpes_missile_splitter
1:59.247 explosive_shot Fluffy_Pillow 100.0/100: 100% focus lock_and_load, oglethorpes_missile_splitter
2:00.252 explosive_shot Fluffy_Pillow 100.0/100: 100% focus oglethorpes_missile_splitter
2:01.258 arcane_shot Fluffy_Pillow 89.6/100: 90% focus oglethorpes_missile_splitter
2:02.262 black_arrow Fluffy_Pillow 64.2/100: 64% focus oglethorpes_missile_splitter
2:03.269 cobra_shot Fluffy_Pillow 33.8/100: 34% focus oglethorpes_missile_splitter
2:05.022 a_murder_of_crows Fluffy_Pillow 41.8/100: 42% focus oglethorpes_missile_splitter
2:06.024 cobra_shot Fluffy_Pillow 30.4/100: 30% focus oglethorpes_missile_splitter
2:07.780 explosive_shot Fluffy_Pillow 38.4/100: 38% focus lock_and_load(2), oglethorpes_missile_splitter
2:08.783 explosive_shot Fluffy_Pillow 57.0/100: 57% focus lock_and_load, balanced_fate
2:09.787 explosive_shot Fluffy_Pillow 61.6/100: 62% focus balanced_fate
2:10.790 dire_beast Fluffy_Pillow 51.2/100: 51% focus balanced_fate
2:11.796 cobra_shot Fluffy_Pillow 57.8/100: 58% focus balanced_fate
2:13.551 barrage Fluffy_Pillow 67.8/100: 68% focus balanced_fate
2:16.459 explosive_shot Fluffy_Pillow 39.1/100: 39% focus balanced_fate
2:17.464 explosive_shot Fluffy_Pillow 28.7/100: 29% focus lock_and_load(2), balanced_fate
2:18.468 explosive_shot Fluffy_Pillow 35.3/100: 35% focus lock_and_load
2:19.474 explosive_shot Fluffy_Pillow 39.9/100: 40% focus
2:20.478 arcane_shot Fluffy_Pillow 31.5/100: 31% focus
2:21.483 explosive_shot Fluffy_Pillow 8.0/100: 8% focus lock_and_load(2), balanced_fate
2:22.488 explosive_shot Fluffy_Pillow 12.6/100: 13% focus lock_and_load, balanced_fate
2:23.493 explosive_shot Fluffy_Pillow 19.2/100: 19% focus balanced_fate
2:24.496 cobra_shot Fluffy_Pillow 8.8/100: 9% focus balanced_fate
2:26.251 cobra_shot Fluffy_Pillow 16.8/100: 17% focus balanced_fate
2:28.005 black_arrow Fluffy_Pillow 38.9/100: 39% focus balanced_fate
2:29.009 cobra_shot Fluffy_Pillow 22.4/100: 22% focus balanced_fate
2:30.765 explosive_shot Fluffy_Pillow 30.5/100: 30% focus
2:31.769 cobra_shot Fluffy_Pillow 34.1/100: 34% focus
2:33.523 cobra_shot Fluffy_Pillow 42.1/100: 42% focus
2:35.278 arcane_shot Fluffy_Pillow 64.1/100: 64% focus
2:36.284 cobra_shot Fluffy_Pillow 52.7/100: 53% focus
2:38.038 explosive_shot Fluffy_Pillow 60.7/100: 61% focus
2:39.043 barrage Fluffy_Pillow 64.3/100: 64% focus
2:42.000 dire_beast Fluffy_Pillow 17.8/100: 18% focus
2:43.004 cobra_shot Fluffy_Pillow 24.4/100: 24% focus oglethorpes_missile_splitter
2:44.760 explosive_shot Fluffy_Pillow 34.4/100: 34% focus oglethorpes_missile_splitter
2:45.765 cobra_shot Fluffy_Pillow 40.0/100: 40% focus oglethorpes_missile_splitter
2:47.519 cobra_shot Fluffy_Pillow 50.1/100: 50% focus oglethorpes_missile_splitter
2:49.273 explosive_shot Fluffy_Pillow 74.1/100: 74% focus lock_and_load(2), oglethorpes_missile_splitter
2:50.275 explosive_shot Fluffy_Pillow 92.6/100: 93% focus lock_and_load, oglethorpes_missile_splitter
2:51.278 explosive_shot Fluffy_Pillow 99.2/100: 99% focus oglethorpes_missile_splitter
2:52.282 black_arrow Fluffy_Pillow 88.8/100: 89% focus oglethorpes_missile_splitter
2:53.285 arcane_shot Fluffy_Pillow 60.4/100: 60% focus oglethorpes_missile_splitter
2:54.289 cobra_shot Fluffy_Pillow 37.0/100: 37% focus oglethorpes_missile_splitter
2:56.042 cobra_shot Fluffy_Pillow 45.0/100: 45% focus
2:57.794 explosive_shot Fluffy_Pillow 67.0/100: 67% focus oglethorpes_missile_splitter
2:58.799 cobra_shot Fluffy_Pillow 70.6/100: 71% focus oglethorpes_missile_splitter
3:00.553 barrage Fluffy_Pillow 78.6/100: 79% focus oglethorpes_missile_splitter
3:03.378 cobra_shot Fluffy_Pillow 45.5/100: 46% focus oglethorpes_missile_splitter
3:05.134 explosive_shot Fluffy_Pillow 53.6/100: 54% focus oglethorpes_missile_splitter
3:06.140 a_murder_of_crows Fluffy_Pillow 57.2/100: 57% focus oglethorpes_missile_splitter
3:07.147 arcane_shot Fluffy_Pillow 31.8/100: 32% focus balanced_fate, oglethorpes_missile_splitter
3:08.150 cobra_shot Fluffy_Pillow 6.4/100: 6% focus balanced_fate, oglethorpes_missile_splitter
3:09.905 cobra_shot Fluffy_Pillow 14.4/100: 14% focus balanced_fate
3:11.661 explosive_shot Fluffy_Pillow 36.4/100: 36% focus balanced_fate
3:12.668 dire_beast Fluffy_Pillow 40.0/100: 40% focus balanced_fate
3:13.674 explosive_shot Fluffy_Pillow 46.6/100: 47% focus lock_and_load(2), balanced_fate
3:14.680 explosive_shot Fluffy_Pillow 53.2/100: 53% focus lock_and_load, balanced_fate
3:15.685 explosive_shot Fluffy_Pillow 57.8/100: 58% focus balanced_fate
3:16.690 black_arrow Fluffy_Pillow 49.4/100: 49% focus
3:17.692 cobra_shot Fluffy_Pillow 19.0/100: 19% focus
3:19.446 cobra_shot Fluffy_Pillow 29.0/100: 29% focus
3:21.201 explosive_shot Fluffy_Pillow 53.0/100: 53% focus lock_and_load(2)
3:22.205 explosive_shot Fluffy_Pillow 73.6/100: 74% focus lock_and_load
3:23.208 explosive_shot Fluffy_Pillow 80.2/100: 80% focus
3:24.212 arcane_shot Fluffy_Pillow 69.8/100: 70% focus
3:25.218 cobra_shot Fluffy_Pillow 46.4/100: 46% focus
3:26.972 cobra_shot Fluffy_Pillow 54.4/100: 54% focus
3:28.727 barrage Fluffy_Pillow 76.4/100: 76% focus
3:31.633 explosive_shot Fluffy_Pillow 43.7/100: 44% focus
3:32.637 cobra_shot Fluffy_Pillow 33.3/100: 33% focus
3:34.391 cobra_shot Fluffy_Pillow 41.3/100: 41% focus
3:36.148 explosive_shot Fluffy_Pillow 63.3/100: 63% focus lock_and_load(2)
3:37.153 explosive_shot Fluffy_Pillow 81.9/100: 82% focus lock_and_load
3:38.158 explosive_shot Fluffy_Pillow 86.5/100: 87% focus
3:39.164 arcane_shot Fluffy_Pillow 76.1/100: 76% focus
3:40.168 cobra_shot Fluffy_Pillow 50.7/100: 51% focus
3:41.922 black_arrow Fluffy_Pillow 58.7/100: 59% focus
3:42.925 dire_beast Fluffy_Pillow 42.3/100: 42% focus
3:43.928 cobra_shot Fluffy_Pillow 48.9/100: 49% focus
3:45.680 explosive_shot Fluffy_Pillow 58.9/100: 59% focus
3:46.684 cobra_shot Fluffy_Pillow 64.5/100: 64% focus
3:48.438 cobra_shot Fluffy_Pillow 74.5/100: 75% focus
3:50.194 barrage Fluffy_Pillow 98.5/100: 99% focus
3:53.091 explosive_shot Fluffy_Pillow 67.8/100: 68% focus
3:54.097 arcane_shot Fluffy_Pillow 59.4/100: 59% focus
3:55.101 explosive_shot Fluffy_Pillow 34.0/100: 34% focus lock_and_load(2), balanced_fate
3:56.107 explosive_shot Fluffy_Pillow 40.6/100: 41% focus lock_and_load, balanced_fate
3:57.112 explosive_shot Fluffy_Pillow 45.2/100: 45% focus lock_and_load(2), balanced_fate
3:58.116 explosive_shot Fluffy_Pillow 49.7/100: 50% focus lock_and_load, balanced_fate
3:59.119 explosive_shot Fluffy_Pillow 54.3/100: 54% focus balanced_fate
4:00.123 cobra_shot Fluffy_Pillow 43.9/100: 44% focus balanced_fate
4:01.879 cobra_shot Fluffy_Pillow 51.9/100: 52% focus balanced_fate
4:03.633 cobra_shot Fluffy_Pillow 74.0/100: 74% focus balanced_fate
4:05.387 explosive_shot Fluffy_Pillow 96.0/100: 96% focus
4:06.392 black_arrow Fluffy_Pillow 99.6/100: 100% focus
4:07.397 a_murder_of_crows Fluffy_Pillow 69.2/100: 69% focus
4:08.402 arcane_shot Fluffy_Pillow 43.8/100: 44% focus
4:09.406 cobra_shot Fluffy_Pillow 18.3/100: 18% focus
4:11.161 cobra_shot Fluffy_Pillow 26.4/100: 26% focus
4:12.915 explosive_shot Fluffy_Pillow 48.4/100: 48% focus
4:13.919 explosive_shot Fluffy_Pillow 52.0/100: 52% focus lock_and_load(2), balanced_fate
4:14.925 explosive_shot Fluffy_Pillow 56.6/100: 57% focus lock_and_load, balanced_fate
4:15.928 explosive_shot Fluffy_Pillow 61.2/100: 61% focus lock_and_load(2), balanced_fate
4:16.932 explosive_shot Fluffy_Pillow 65.7/100: 66% focus lock_and_load, balanced_fate
4:17.935 explosive_shot Fluffy_Pillow 70.3/100: 70% focus balanced_fate
4:18.940 dire_beast Fluffy_Pillow 59.9/100: 60% focus balanced_fate
4:19.944 barrage Fluffy_Pillow 66.5/100: 67% focus balanced_fate
4:22.826 cobra_shot Fluffy_Pillow 23.7/100: 24% focus balanced_fate
4:24.580 explosive_shot Fluffy_Pillow 33.7/100: 34% focus lock_and_load(2)
4:25.585 explosive_shot Fluffy_Pillow 52.3/100: 52% focus lock_and_load
4:26.589 explosive_shot Fluffy_Pillow 58.9/100: 59% focus oglethorpes_missile_splitter
4:27.594 arcane_shot Fluffy_Pillow 48.5/100: 48% focus oglethorpes_missile_splitter
4:28.601 cobra_shot Fluffy_Pillow 25.1/100: 25% focus oglethorpes_missile_splitter
4:30.355 potion Fluffy_Pillow 35.1/100: 35% focus oglethorpes_missile_splitter
4:30.355 cobra_shot Fluffy_Pillow 35.1/100: 35% focus oglethorpes_missile_splitter, draenic_agility_potion
4:32.110 black_arrow Fluffy_Pillow 59.1/100: 59% focus oglethorpes_missile_splitter, draenic_agility_potion
4:33.113 explosive_shot Fluffy_Pillow 42.7/100: 43% focus oglethorpes_missile_splitter, draenic_agility_potion
4:34.116 cobra_shot Fluffy_Pillow 32.3/100: 32% focus oglethorpes_missile_splitter, draenic_agility_potion
4:35.871 explosive_shot Fluffy_Pillow 40.3/100: 40% focus lock_and_load(2), oglethorpes_missile_splitter, draenic_agility_potion
4:36.875 explosive_shot Fluffy_Pillow 58.9/100: 59% focus lock_and_load, oglethorpes_missile_splitter, draenic_agility_potion
4:37.878 explosive_shot Fluffy_Pillow 63.5/100: 63% focus oglethorpes_missile_splitter, draenic_agility_potion
4:38.883 cobra_shot Fluffy_Pillow 53.1/100: 53% focus oglethorpes_missile_splitter, draenic_agility_potion
4:40.636 arcane_shot Fluffy_Pillow 61.1/100: 61% focus oglethorpes_missile_splitter, draenic_agility_potion
4:41.640 cobra_shot Fluffy_Pillow 49.7/100: 50% focus oglethorpes_missile_splitter, draenic_agility_potion
4:43.394 cobra_shot Fluffy_Pillow 57.7/100: 58% focus oglethorpes_missile_splitter, draenic_agility_potion
4:45.148 explosive_shot Fluffy_Pillow 79.7/100: 80% focus draenic_agility_potion
4:46.152 barrage Fluffy_Pillow 83.3/100: 83% focus draenic_agility_potion
4:48.949 dire_beast Fluffy_Pillow 36.1/100: 36% focus draenic_agility_potion
4:49.954 cobra_shot Fluffy_Pillow 42.7/100: 43% focus draenic_agility_potion
4:51.708 explosive_shot Fluffy_Pillow 52.7/100: 53% focus draenic_agility_potion
4:52.713 arcane_shot Fluffy_Pillow 58.3/100: 58% focus draenic_agility_potion
4:53.716 arcane_shot Fluffy_Pillow 32.9/100: 33% focus draenic_agility_potion
4:54.720 cobra_shot Fluffy_Pillow 9.5/100: 9% focus draenic_agility_potion

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 930 886 886
Agility 4620 4137 4005 (1492)
Stamina 4669 4245 4245
Intellect 895 853 853
Spirit 713 713 713
Health 280140 254700 0
Focus 100 100 0
Crit 32.03% 25.21% 1123
Haste 14.27% 8.83% 883
Multistrike 12.39% 7.39% 488
Damage / Heal Versatility 6.58% 3.58% 466
Attack Power 5082 4137 0
Mastery 17.03% 12.03% 443
Armor 1270 1270 1270
Run Speed 0 0 90

Talents

Level
15 Posthaste Narrow Escape Crouching Tiger, Hidden Chimaera
30 Binding Shot Wyvern Sting Intimidation
45 Exhilaration Iron Hawk Spirit Bond
60 Steady Focus Dire Beast Thrill of the Hunt
75 A Murder of Crows Blink Strikes Stampede
90 Glaive Toss Powershot Barrage
100 Exotic Munitions Focusing Shot (Survival Hunter) Lone Wolf

Profile

hunter="Rosalîîe"
origin="http://eu.battle.net/wow/en/character/die-nachtwache/Rosalîîe/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/37/85695781-avatar.jpg"
level=100
race=pandaren_alliance
role=attack
position=ranged_back
professions=engineering=700/enchanting=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Yb!0011022
glyphs=deterrence/black_ice/liberation/aspect_of_the_cheetah
spec=survival

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_agility_flask
actions.precombat+=/food,type=blackrock_barbecue
actions.precombat+=/summon_pet
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/exotic_munitions,ammo_type=poisoned,if=active_enemies<3
actions.precombat+=/exotic_munitions,ammo_type=incendiary,if=active_enemies>=3
actions.precombat+=/potion,name=draenic_agility

# Executed every time the actor is available.

actions=auto_shot
actions+=/arcane_torrent,if=focus.deficit>=30
actions+=/blood_fury
actions+=/berserking
actions+=/potion,name=draenic_agility,if=(((cooldown.stampede.remains<1)&(cooldown.a_murder_of_crows.remains<1))&(trinket.stat.any.up|buff.archmages_greater_incandescence_agi.up))|target.time_to_die<=25
actions+=/call_action_list,name=aoe,if=active_enemies>1
actions+=/stampede,if=buff.potion.up|(cooldown.potion.remains&(buff.archmages_greater_incandescence_agi.up|trinket.stat.any.up))|target.time_to_die<=25
actions+=/black_arrow,if=!ticking
actions+=/explosive_shot
actions+=/a_murder_of_crows
actions+=/dire_beast
actions+=/arcane_shot,if=buff.thrill_of_the_hunt.react&focus>35&cast_regen<=focus.deficit|dot.serpent_sting.remains<=3|target.time_to_die<4.5
actions+=/glaive_toss
actions+=/powershot
actions+=/barrage
# Cast a second shot for steady focus if that won't cap us.
actions+=/cobra_shot,if=buff.pre_steady_focus.up&buff.steady_focus.remains<5&(14+cast_regen)<=focus.deficit<80
actions+=/arcane_shot,if=focus>=80|talent.focusing_shot.enabled
actions+=/focusing_shot
actions+=/cobra_shot

actions.aoe=stampede,if=buff.potion.up|(cooldown.potion.remains&(buff.archmages_greater_incandescence_agi.up|trinket.stat.any.up|buff.archmages_incandescence_agi.up))
actions.aoe+=/explosive_shot,if=buff.lock_and_load.react&(!talent.barrage.enabled|cooldown.barrage.remains>0)
actions.aoe+=/barrage
actions.aoe+=/black_arrow,if=!ticking
actions.aoe+=/explosive_shot,if=active_enemies<5
actions.aoe+=/explosive_trap,if=dot.explosive_trap.remains<=5
actions.aoe+=/a_murder_of_crows
actions.aoe+=/dire_beast
actions.aoe+=/multishot,if=buff.thrill_of_the_hunt.react&focus>50&cast_regen<=focus.deficit|dot.serpent_sting.remains<=5|target.time_to_die<4.5
actions.aoe+=/glaive_toss
actions.aoe+=/powershot
actions.aoe+=/cobra_shot,if=buff.pre_steady_focus.up&buff.steady_focus.remains<5&focus+14+cast_regen<80
actions.aoe+=/multishot,if=focus>=70|talent.focusing_shot.enabled
actions.aoe+=/focusing_shot
actions.aoe+=/cobra_shot

head=hood_of_dispassionate_execution,id=113608
neck=firecrystal_chain,id=118840,enchant=75mult
shoulders=living_mountain_shoulderguards,id=113641,bonus_id=42
back=cloak_of_creeping_necrosis,id=113657,bonus_id=563,gems=50mult,enchant=gift_of_multistrike
chest=mosswoven_mailshirt,id=113654,bonus_id=561/566
wrists=bracers_of_the_crying_chorus,id=113826,bonus_id=566
hands=grips_of_vicious_mauling,id=113593,bonus_id=566
waist=belt_of_imminent_lies,id=113827,bonus_id=566
legs=legguards_of_ravenous_assault,id=116032
feet=treads_of_sand_and_blood,id=113595,bonus_id=566
finger1=shifting_taladite_ring,id=115796,bonus_id=234/525/540,enchant=50mult
finger2=timeless_solium_band_of_the_assassin,id=118297,enchant=50mult
trinket1=bloodmaws_tooth,id=116289
trinket2=scales_of_doom,id=113612,bonus_id=566
main_hand=crystalline_branch_of_the_brackenspore,id=113652,bonus_id=566,enchant=oglethorpes_missile_splitter

# Gear Summary
# gear_agility=2659
# gear_stamina=3354
# gear_crit_rating=1123
# gear_haste_rating=883
# gear_mastery_rating=443
# gear_armor=1270
# gear_multistrike_rating=465
# gear_versatility_rating=466
# gear_speed_rating=90
summon_pet=cat

Procrank

Procrank : 28558 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
28558.2 28558.2 12.9 / 0.045% 3981.8 / 13.9% 7.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
2741.8 2741.8 Mana 0.00% 44.2 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Procrank/advanced
Talents
  • 15: Ice Floes
  • 30: Ice Barrier
  • 45: Ring of Frost
  • 60: Cauterize
  • 75: Ice Nova (Frost Mage)
  • 90: Mirror Image
  • 100: Thermal Void (Frost Mage)
  • Talent Calculator
Glyphs
  • Glyph of Icy Veins
  • Glyph of Water Elemental
  • Glyph of Splitting Ice
  • Glyph of the Unbound Elemental
  • Glyph of Illusion
  • Glyph of Rapid Teleportation
Professions
  • inscription: 700
  • tailoring: 645

Charts

http://9.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Procrank+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x210&chd=t:426440|41756|41696|38504|23761|12937&chds=0,852879&chco=69CCF0,9900CC,0070DE,0070DE,0070DE,0070DE&chm=t++426440++mirror_image,69CCF0,0,0,15|t++41756++frostfire_bolt,9900CC,1,0,15|t++41696++ice_nova,0070DE,2,0,15|t++38504++frozen_orb,0070DE,3,0,15|t++23761++ice_lance,0070DE,4,0,15|t++12937++frostbolt,0070DE,5,0,15& http://0.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Procrank+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:24,22,20,18,11,11,10,8,4,2&chds=0,100&chdls=ffffff&chco=0070DE,0070DE,9900CC,0070DE,0070DE,0070DE,0070DE,9900CC,0070DE,0070DE&chl=ice_lance|frostbolt|frostfire_bolt|mirror_image: frostbolt|ice_nova|water_elemental: waterbolt|icicle_fb|icicle_ffb|frozen_orb_bolt|water_elemental: water_jet&
http://2.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Procrank+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:fikorux0357685344553100yxxutstrrqpnlkgfeddcbaZYXWUUSSSTTTTUUUUTTTTUWWWWWVVUUUTTTTSSSSSRQQQQRSTTTTTTTTTTTTTTTTTTRQQRSTVWXXYYZaabccdeffgffdccbbcdcccbbbaaaaZZZZZZYYXVUUUTTSSTUUUUVWWXXYZabcddefgfghiihgfffeeddccbbaZZXVVVVVWWWWVVUUUTTTTTTTSSSSSTTUVXYZaabbcdeeffffeeedcbaaabccbbaaZZZZZYYYYXXWWUTTSSSTTTTTTTTTTTUUUUUUVVUTUUUVVVUUTTTSSSSSSSSRRRSRQRRRSTTTTTTTTTSTSSTTTUUUUTTTSRQPPONML&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.453428,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=28558|max=62983&chxp=1,1,45,100 http://5.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Procrank+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:3,6,6,14,33,47,107,110,188,292,401,487,587,734,834,883,1061,1097,1189,1268,1343,1329,1300,1333,1304,1266,1258,1124,1053,911,723,636,528,411,305,262,203,110,87,59,42,29,14,12,5,2,0,0,0,4&chds=0,1343&chbh=5&chxt=x&chxl=0:|min=25172|avg=28558|max=32739&chxp=0,1,45,100& http://1.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Procrank+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:54.7,21.5,14.6,5.8,2.5,0.9&chds=0,100&chdls=ffffff&chco=0070DE,0070DE,9900CC,0070DE,0070DE,69CCF0&chl=frostbolt 164.5s|ice_lance 64.8s|frostfire_bolt 43.8s|ice_nova 17.5s|frozen_orb 7.4s|mirror_image 2.8s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Procrank 28558
frostbolt 4866 (7082) 17.1% (24.8%) 98.5 3.03sec 21597 12937 Direct 98.3 9956 20044 11463 14.9% 95.8 3029 6121 15.4%  

Stats details: frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.52 98.29 0.00 0.00 1.6694 0.0000 1462442.01 1462442.01 0.00 12936.59 12936.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 14.72 15.36% 6120.63 5847 6970 6124.96 5847 6809 90074 90074 0.00
multistrike 81.11 84.64% 3029.10 2923 3485 3030.57 2957 3152 245680 245680 0.00
hit 83.61 85.06% 9956.18 9745 11616 9959.76 9790 10170 832420 832420 0.00
crit 14.68 14.94% 20044.04 19490 23232 20054.60 19490 22296 294268 294268 0.00
 
DPS Timeline Chart
 

Action details: frostbolt

Static Values
  • id:116
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6400.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:$?$w1=0[][Movement slowed by $w1%.]
  • description:Launches a bolt of frost at the enemy, causing {$s2=1659} Frost damage and slowing movement speed by {$s1=50}% for {$d=15 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.191000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    icicle_fb 2215 7.8% 192.1 1.95sec 3464 0 Direct 190.9 3485 0 3485 0.0% 0.0 0 0 0.0%  

Stats details: icicle_fb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 192.05 190.88 0.00 0.00 0.0000 0.0000 665213.17 665213.17 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 190.88 100.00% 3484.94 1233 16408 3488.98 2748 4575 665213 665213 0.00
 
DPS Timeline Chart
 

Action details: icicle

Static Values
  • id:148022
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:148022
  • name:Icicle
  • school:frost
  • tooltip:
  • description:{$@spelldesc76613=When you damage enemies with Frostbolt and Frostfire Bolt, and their multistrikes, {$s1=0}% of the damage done is stored as an Icicle with you, for {$148012d=30 seconds}. Also increases the damage of your Water Elemental's Waterbolt by {$s3=0}%. Up to {$s2=5} Icicles can be stored at once. Casting Ice Lance causes any Icicles to begin launching at the target.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3966.11
  • base_dd_max:3966.11
 
frostfire_bolt 4355 (6108) 15.2% (21.4%) 33.6 8.71sec 54500 41756 Direct 33.5 16756 33814 29217 73.0% 36.4 5107 10343 73.6%  

Stats details: frostfire_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.59 33.52 0.00 0.00 1.3052 0.0000 1305567.51 1305567.51 0.00 41755.76 41755.76
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 26.79 73.61% 10342.63 9793 11674 10349.73 9793 11152 277050 277050 0.00
multistrike 9.60 26.39% 5107.37 4897 5837 5110.33 0 5837 49049 49049 0.00
hit 9.03 26.95% 16755.95 16322 19457 16761.90 0 19457 151388 151388 0.00
crit 24.49 73.05% 33813.96 32645 38915 33834.64 32645 35989 828081 828081 0.00
 
DPS Timeline Chart
 

Action details: frostfire_bolt

Static Values
  • id:44614
  • school:frostfire
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6400.0
  • cooldown:0.000
  • base_execute_time:2.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.brain_freeze.react
Spelldata
  • id:44614
  • name:Frostfire Bolt
  • school:frostfire
  • tooltip:Movement slowed by {$s1=40}%.
  • description:Launches a bolt of frostfire at the enemy, causing $?a57761[${$m2*1.25} to ${$M2*1.25}][{$s2=2208}] Frostfire damage and slowing the target's movement by {$s1=40}% for {$d=8 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.586000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    icicle_ffb 1752 6.1% 69.2 4.51sec 7592 0 Direct 68.8 7630 0 7630 0.0% 0.0 0 0 0.0%  

Stats details: icicle_ffb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.18 68.83 0.00 0.00 0.0000 0.0000 525213.57 525213.57 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 68.83 100.00% 7630.40 1233 16408 7640.49 5947 9716 525214 525214 0.00
 
DPS Timeline Chart
 

Action details: icicle

Static Values
  • id:148022
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:148022
  • name:Icicle
  • school:frost
  • tooltip:
  • description:{$@spelldesc76613=When you damage enemies with Frostbolt and Frostfire Bolt, and their multistrikes, {$s1=0}% of the damage done is stored as an Icicle with you, for {$148012d=30 seconds}. Also increases the damage of your Water Elemental's Waterbolt by {$s3=0}%. Up to {$s2=5} Icicles can be stored at once. Casting Ice Lance causes any Icicles to begin launching at the target.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3966.11
  • base_dd_max:3966.11
 
frozen_orb 0 (957) 0.0% (3.3%) 5.4 61.08sec 52840 38504

Stats details: frozen_orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.43 5.43 53.22 53.22 1.3725 1.0000 0.00 0.00 0.00 4726.41 38503.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.43 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.7 82.09% 0.00 0 0 0.00 0 0 0 0 0.00
crit 9.5 17.91% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: frozen_orb

Static Values
  • id:84714
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:16000.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:84714
  • name:Frozen Orb
  • school:frost
  • tooltip:
  • description:Launches a Frozen Orb forward from the Mage's position, releasing Frostbolts that deal {$84721s2=534} Frost damage to all nearby enemy targets for {$d=10 seconds}. Grants the Mage 1 charge of Fingers of Frost when it first reaches a target. Targets damaged by the Frost Orb are slowed by {$84721s1=30}% for {$84721d=2 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    frozen_orb_bolt 957 3.3% 0.0 0.00sec 0 0 Direct 53.2 3364 6716 3966 18.0% 61.6 1043 2084 17.9%  

Stats details: frozen_orb_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 53.22 0.00 0.00 0.0000 0.0000 286737.33 286737.33 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 11.02 17.90% 2083.52 1882 2243 2085.42 1882 2243 22953 22953 0.00
multistrike 50.54 82.10% 1043.22 941 1122 1044.40 1003 1102 52727 52727 0.00
hit 43.67 82.05% 3363.98 3137 3739 3367.86 3265 3518 146888 146888 0.00
crit 9.55 17.95% 6716.18 6273 7478 6721.71 0 7478 64170 64170 0.00
 
DPS Timeline Chart
 

Action details: frozen_orb_bolt

Static Values
  • id:84721
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:84721
  • name:Frozen Orb
  • school:frost
  • tooltip:Movement slowed by {$s1=30}%.
  • description:{$@spelldesc84714=Launches a Frozen Orb forward from the Mage's position, releasing Frostbolts that deal {$84721s2=534} Frost damage to all nearby enemy targets for {$d=10 seconds}. Grants the Mage 1 charge of Fingers of Frost when it first reaches a target. Targets damaged by the Frost Orb are slowed by {$84721s1=30}% for {$84721d=2 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.383250
  • base_dd_min:1.00
  • base_dd_max:1.00
 
ice_lance 5126 18.0% 49.0 6.10sec 31409 23761 Direct 48.8 13592 27344 23762 74.0% 51.6 4178 8420 74.4%  

Stats details: ice_lance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.99 48.82 0.00 0.00 1.3219 0.0000 1538645.94 1538645.94 0.00 23761.04 23761.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 38.40 74.40% 8420.32 7854 9362 8427.46 7995 9173 323318 323318 0.00
multistrike 13.21 25.60% 4178.07 3927 4681 4181.72 3927 4681 55199 55199 0.00
hit 12.72 26.05% 13591.94 13089 15603 13600.45 13089 15184 172864 172864 0.00
crit 36.11 73.95% 27343.96 26179 31207 27364.10 26308 28886 987266 987266 0.00
 
DPS Timeline Chart
 

Action details: ice_lance

Static Values
  • id:30455
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1600.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&active_dot.frozen_orb>=1)
Spelldata
  • id:30455
  • name:Ice Lance
  • school:frost
  • tooltip:
  • description:Deals $?a44544[${$m1*$<fingersMult>} to ${$M1*$<fingersMult>}][{$s1=557}] Frost damage to an enemy target{$?s56377=true}&!a44544[, and ${$m1*$56377m2/100} to ${$M1*$56377m2/100} Frost damage to a second nearby target][]{$?s56377=true}&a44544[, and ${$m1*$<fingersMult>*$56377m2/100} to ${$M1*$<fingersMult>*$56377m2/100} Frost damage to a second nearby target][]. Ice Lance damage is doubled against frozen targets. Replaces Fire Blast.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
ice_nova 2435 8.5% 13.4 23.09sec 54287 41696 Direct 13.4 34576 69397 39972 15.5% 15.6 10667 21434 15.8%  

Stats details: ice_nova

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.45 13.45 0.00 0.00 1.3020 0.0000 730052.89 730052.89 0.00 41695.86 41695.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.46 15.78% 21433.94 19636 23407 19791.44 0 23407 52647 52647 0.00
multistrike 13.11 84.22% 10667.17 9818 11703 10684.83 9989 11703 139866 139866 0.00
hit 11.36 84.50% 34576.21 32726 39011 34601.35 32726 36916 392931 392931 0.00
crit 2.08 15.50% 69397.16 65452 78022 61936.92 0 78022 144609 144609 0.00
 
DPS Timeline Chart
 

Action details: ice_nova

Static Values
  • id:157997
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:25.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=2
Spelldata
  • id:157997
  • name:Ice Nova
  • school:frost
  • tooltip:Frozen.
  • description:Causes a whirl of icy wind around the target enemy or ally, dealing {$s2=2785} Frost damage to all enemies within $A2 yards, and freezing for {$d=2 seconds}. A primary enemy target will take {$s1=100}% increased damage. Max 2 charges. Replaces Frost Nova.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
mirror_image 0 (3924) 0.0% (13.7%) 3.0 120.86sec 390533 426440

Stats details: mirror_image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 0.9159 0.0000 0.00 0.00 0.00 426439.56 426439.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.53 84.23% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.47 15.77% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: mirror_image

Static Values
  • id:55342
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3200.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:
  • description:Creates {$s2=3} copies of the caster nearby, which cast spells and attack the Mage's enemies. Lasts {$55342d=40 seconds}.
 
    frostbolt (mirror_image) 10541 13.7% 196.9 4.16sec 5963 3612 Direct 195.9 3729 7548 4456 19.0% 219.8 1140 2317 19.5%  

Stats details: frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 196.86 195.91 0.00 0.00 1.6508 0.0000 1173988.11 1173988.11 0.00 3612.49 3612.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 42.86 19.50% 2317.25 2160 2575 2318.71 2190 2512 99313 99313 0.00
multistrike 176.94 80.50% 1139.98 1080 1287 1140.58 1114 1180 201704 201704 0.00
hit 158.61 80.96% 3728.60 3600 4291 3730.54 3677 3817 591380 591380 0.00
crit 37.31 19.04% 7547.74 7199 8582 7553.10 7228 8084 281592 281592 0.00
 
DPS Timeline Chart
 

Action details: frostbolt

Static Values
  • id:59638
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.550000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - water_elemental 2927 / 2927
water_jet 506 1.8% 10.0 30.36sec 15230 3511 Periodic 39.7 2525 5095 2935 16.0% 39.3 777 1573 16.5% 11.5%

Stats details: water_jet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.99 9.99 39.68 39.68 4.3377 0.8728 152165.60 152165.60 0.00 3511.14 3511.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 6.5 16.50% 1572.56 1461 1741 1572.71 0 1741 10193 10193 0.00
multistrike 32.8 83.50% 777.38 730 871 778.34 741 829 25504 25504 0.00
hit 33.3 84.04% 2525.08 2434 2902 2526.74 2460 2597 84205 84205 0.00
crit 6.3 15.96% 5095.43 4869 5804 5093.40 0 5804 32263 32263 0.00
 
DPS Timeline Chart
 

Action details: water_jet

Static Values
  • id:135029
  • school:frost
  • resource:none
  • range:45.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:25.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:135029
  • name:Water Jet
  • school:frost
  • tooltip:Taking {$s1=0} damage every $t1 sec. Frostbolts from the Water Elemental's owner that hit the target will grant a charge of Fingers of Frost.
  • description:Channels a jet of icy water at the target, dealing $o1 Frost damage to the target over {$d=4 seconds}. The Mage's Frostbolts that hit the target while it is being blasted with icy water will grant a charge of Fingers of Frost.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.282000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
waterbolt 2421 8.5% 112.2 2.67sec 6482 2946 Direct 111.2 4301 8658 4963 15.2% 114.9 1314 2652 15.6%  

Stats details: waterbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 112.15 111.24 0.00 0.00 2.2001 0.0000 726979.74 726979.74 0.00 2946.26 2946.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 17.90 15.58% 2652.09 2512 2995 2653.89 2512 2951 47464 47464 0.00
multistrike 96.97 84.42% 1313.82 1256 1497 1314.55 1285 1357 127402 127402 0.00
hit 94.35 84.81% 4301.39 4187 4991 4303.26 4238 4374 405833 405833 0.00
crit 16.89 15.19% 8658.50 8374 9982 8663.66 8374 9523 146281 146281 0.00
 
DPS Timeline Chart
 

Action details: waterbolt

Static Values
  • id:31707
  • school:frost
  • resource:none
  • range:45.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:31707
  • name:Waterbolt
  • school:frost
  • tooltip:
  • description:Deals {$s1=675} Frost damage to the target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.485000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - mirror_image 10541 / 3924
frostbolt 10541 13.7% 196.9 4.16sec 5963 3612 Direct 195.9 3729 7548 4456 19.0% 219.8 1140 2317 19.5%  

Stats details: frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 196.86 195.91 0.00 0.00 1.6508 0.0000 1173988.11 1173988.11 0.00 3612.49 3612.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 42.86 19.50% 2317.25 2160 2575 2318.71 2190 2512 99313 99313 0.00
multistrike 176.94 80.50% 1139.98 1080 1287 1140.58 1114 1180 201704 201704 0.00
hit 158.61 80.96% 3728.60 3600 4291 3730.54 3677 3817 591380 591380 0.00
crit 37.31 19.04% 7547.74 7199 8582 7553.10 7228 8084 281592 281592 0.00
 
DPS Timeline Chart
 

Action details: frostbolt

Static Values
  • id:59638
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.550000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Procrank
counterspell 7.2 43.27sec

Stats details: counterspell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.17 7.17 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.17 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: counterspell

Static Values
  • id:2139
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:3200.0
  • cooldown:24.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.debuff.casting.react
Spelldata
  • id:2139
  • name:Counterspell
  • school:arcane
  • tooltip:
  • description:Counters the enemy's spellcast, preventing any spell from that school of magic from being cast for {$d=6 seconds}$?s12598[ and silencing the target for $55021d.][.]
 
draenic_intellect_potion 2.0 0.00sec

Stats details: draenic_intellect_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156426
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156426
  • name:Draenic Intellect Potion
  • school:physical
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
 
icy_veins 2.1 181.29sec

Stats details: icy_veins

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.06 2.06 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.77 86.02% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.29 13.98% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: icy_veins

Static Values
  • id:12472
  • school:frost
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:12472
  • name:Icy Veins
  • school:frost
  • tooltip:$?$w3>0[Multistrike chance increased by $w3%][Haste increased by $w1%] and immune to pushback.
  • description:Accelerates your spellcasting, granting {$?s56364=true}[{$s3=0}% multistrike chance][$m1% haste] and preventing spell pushback.$?s56374[ Casting Icy Veins removes all movement slowing and cast time slowing effects.][] Lasts {$d=20 seconds}.
 
water_elemental 1.0 0.00sec

Stats details: water_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.87 87.14% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.13 12.86% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: water_elemental

Static Values
  • id:31687
  • school:frost
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:4800.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:31687
  • name:Summon Water Elemental
  • school:frost
  • tooltip:
  • description:Summons a Water Elemental to fight for the caster.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 33.34% 0.0(0.0)

Buff details

  • buff initial source:Procrank
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
brain_freeze 26.6 7.2 11.2sec 8.7sec 22.45% 100.00% 0.0(0.0)

Buff details

  • buff initial source:Procrank
  • cooldown name:buff_brain_freeze
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • brain_freeze_1:21.63%
  • brain_freeze_2:0.82%

Trigger Attempt Success

  • trigger_pct:34.56%

Spelldata details

  • id:57761
  • name:Brain Freeze
  • tooltip:Your next Frostfire Bolt costs no mana, is instant cast, acts as if your target were frozen, and deals {$44549s3=85}% additional damage.
  • description:{$@spelldesc44549=Your Frostbolts have a $m1% chance to cause the Brain Freeze effect. Each multistrike increases that cast's chance by an additional $m2%. The Brain Freeze effect causes your next Frostfire Bolt to cost no mana, be instant cast, deal {$s3=85}% additional damage, and act as if your target were frozen.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
draenic_intellect_potion 2.0 0.0 180.8sec 0.0sec 15.21% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Procrank
  • cooldown name:buff_draenic_intellect_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:1000.00

Stack Uptimes

  • draenic_intellect_potion_1:15.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156426
  • name:Draenic Intellect Potion
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
enhanced_frostbolt 17.5 0.0 17.6sec 18.4sec 7.23% 17.77% 0.0(0.0)

Buff details

  • buff initial source:Procrank
  • cooldown name:buff_enhanced_frostbolt
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • enhanced_frostbolt_1:7.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:157646
  • name:Enhanced Frostbolt
  • tooltip:
  • description:Frostbolt's cast time is reduced by 0.5 sec. This effect is disabled for {$157648d=15 seconds} after you benefit from it.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
fingers_of_frost 34.7 16.5 8.7sec 5.9sec 31.17% 100.00% 1.9(1.9)

Buff details

  • buff initial source:Procrank
  • cooldown name:buff_fingers_of_frost
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • fingers_of_frost_1:26.57%
  • fingers_of_frost_2:4.60%

Trigger Attempt Success

  • trigger_pct:24.70%

Spelldata details

  • id:44544
  • name:Fingers of Frost
  • tooltip:Your next Ice Lance or Deep Freeze act as if your target were frozen and Ice Lance deals $w2% more damage.
  • description:{$@spelldesc112965=Your successful Frostbolts, Frostfire Bolts and Frozen Orb hits have a {$s1=15}% chance, and your Blizzard ticks have a {$s2=5}% chance to grant you the Fingers of Frost effect. The Fingers of Frost effect causes your next Ice Lance or Deep Freeze to act as if your target were frozen, and increases Ice Lance damage by {$44544s2=100}%. Limit {$44544s1=2} charges.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
icy_veins 2.1 0.0 180.9sec 181.3sec 22.53% 24.26% 0.0(0.0)

Buff details

  • buff initial source:Procrank
  • cooldown name:buff_icy_veins
  • max_stacks:1
  • duration:20.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • icy_veins_1:22.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:12472
  • name:Icy Veins
  • tooltip:$?$w3>0[Multistrike chance increased by $w3%][Haste increased by $w1%] and immune to pushback.
  • description:Accelerates your spellcasting, granting {$?s56364=true}[{$s3=0}% multistrike chance][$m1% haste] and preventing spell pushback.$?s56374[ Casting Icy Veins removes all movement slowing and cast time slowing effects.][] Lasts {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
mark_of_the_frostwolf 13.6 4.1 22.7sec 17.2sec 31.37% 31.38% 1.0(1.0)

Buff details

  • buff initial source:Procrank
  • cooldown name:buff_mark_of_the_frostwolf
  • max_stacks:2
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stat Buff details

  • stat:multistrike_rating
  • amount:500.00

Stack Uptimes

  • mark_of_the_frostwolf_1:24.07%
  • mark_of_the_frostwolf_2:7.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:159676
  • name:Mark of the Frostwolf
  • tooltip:Multistrike increased by $w1.
  • description:Increases multistrike by {$s1=500}.
  • max_stacks:2
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
nightmare_fire 2.9 0.0 121.5sec 121.4sec 18.99% 19.00% 0.0(0.0)

Buff details

  • buff initial source:Procrank
  • cooldown name:buff_nightmare_fire
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:crit_rating
  • amount:1396.00

Stack Uptimes

  • nightmare_fire_1:18.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162919
  • name:Nightmare Fire
  • tooltip:Critical strike increased by {$s1=1044}.
  • description:Critical strike increased by {$s1=1044} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
frost_armor

Buff details

  • buff initial source:Procrank
  • cooldown name:buff_frost_armor
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • frost_armor_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:7302
  • name:Frost Armor
  • tooltip:Multistrike increased by $7302w1%. Attackers are slowed.
  • description:Increases multistrike chance by {$s1=8}% and causes enemies who strike the caster to be slowed by {$7321s2=30}% for {$7321d=5 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
greater_draenic_intellect_flask

Buff details

  • buff initial source:Procrank
  • cooldown name:buff_greater_draenic_intellect_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:250.00

Stack Uptimes

  • greater_draenic_intellect_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156079
  • name:Greater Draenic Intellect Flask
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Procrank
counterspell Mana 7.2 22956.1 3200.0 3200.0 0.0
frostbolt Mana 98.5 630512.9 6400.0 6400.0 3.4
frozen_orb Mana 5.4 86823.2 16000.0 15999.8 3.3
ice_lance Mana 49.0 78379.5 1600.0 1600.0 19.6
mirror_image Mana 3.0 6419.6 2135.5 2135.5 182.9
Resource Gains Type Count Total Average Overflow
external_healing Health 8.22 0.00 (0.00%) 0.00 77415.63 100.00%
mp5_regen Mana 200.51 821030.86 (100.00%) 4094.70 164969.59 16.73%
Resource RPS-Gain RPS-Loss
Mana 2728.27 2741.76
Combat End Resource Mean Min Max
Mana 155956.63 135492.15 160000.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
water_elemental 100.0%
water_elemental-water_elemental 100.0%
prismatic_crystal-water_elemental 100.0%
mirror_image-water_elemental 100.0%
mirror_image-water_elemental 100.0%
mirror_image-water_elemental 100.0%
Uptimes %
Mana Cap 19.8%
water_elemental-Mana Cap 19.8%
prismatic_crystal-Mana Cap 19.8%
mirror_image-Mana Cap 19.8%
mirror_image-Mana Cap 19.8%
mirror_image-Mana Cap 19.8%

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Procrank Fight Length
Count 25000
Mean 300.94
Minimum 230.43
Maximum 374.11
Spread ( max - min ) 143.68
Range [ ( max - min ) / 2 * 100% ] 23.87%
DPS
Sample Data Procrank Damage Per Second
Count 25000
Mean 28558.16
Minimum 25172.49
Maximum 32739.25
Spread ( max - min ) 7566.76
Range [ ( max - min ) / 2 * 100% ] 13.25%
Standard Deviation 1043.1052
5th Percentile 26857.65
95th Percentile 30270.46
( 95th Percentile - 5th Percentile ) 3412.80
Mean Distribution
Standard Deviation 6.5972
95.00% Confidence Intervall ( 28545.23 - 28571.09 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 51
0.1% Error 5124
0.1 Scale Factor Error with Delta=300 9288
0.05 Scale Factor Error with Delta=300 37153
0.01 Scale Factor Error with Delta=300 928837
Distribution Chart
DPS(e)
Sample Data Procrank Damage Per Second (Effective)
Count 25000
Mean 28558.16
Minimum 25172.49
Maximum 32739.25
Spread ( max - min ) 7566.76
Range [ ( max - min ) / 2 * 100% ] 13.25%
Damage
Sample Data Procrank Damage
Count 25000
Mean 6513872.42
Minimum 4768534.44
Maximum 8463713.45
Spread ( max - min ) 3695179.01
Range [ ( max - min ) / 2 * 100% ] 28.36%
DTPS
Sample Data Procrank Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Procrank Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Procrank Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Procrank Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Procrank Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Procrank Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data ProcrankTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Procrank Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_intellect_flask
1 0.00 food,type=calamari_crepes
2 0.00 arcane_brilliance
3 0.00 water_elemental
4 0.00 snapshot_stats
5 0.00 rune_of_power
6 0.00 mirror_image
7 0.00 potion,name=draenic_intellect
8 0.00 frostbolt
Default action list Executed every time the actor is available.
# count action,conditions
9 7.17 counterspell,if=target.debuff.casting.react
A 0.00 blink,if=movement.distance>10
B 0.00 blazing_speed,if=movement.remains>0
C 0.00 time_warp,if=target.health.pct<25|time>5
D 2.01 mirror_image
E 0.00 ice_floes,if=buff.ice_floes.down&(raid_event.movement.distance>0|raid_event.movement.in<action.frostbolt.cast_time)
F 0.00 rune_of_power,if=buff.rune_of_power.remains<cast_time
G 0.00 rune_of_power,if=(cooldown.icy_veins.remains<gcd.max&buff.rune_of_power.remains<20)|(cooldown.prismatic_crystal.remains<gcd.max&buff.rune_of_power.remains<10)
H 0.00 call_action_list,name=cooldowns,if=time_to_die<24
I 0.00 call_action_list,name=crystal_sequence,if=talent.prismatic_crystal.enabled&(cooldown.prismatic_crystal.remains<=gcd.max|pet.prismatic_crystal.active)
J 0.00 call_action_list,name=aoe,if=active_enemies>=4
K 0.00 call_action_list,name=single_target
actions.cooldowns
# count action,conditions
X 2.06 icy_veins
Consolidated damage cooldown abilities
Y 0.00 blood_fury
Z 0.00 berserking
a 0.00 arcane_torrent
b 1.00 potion,name=draenic_intellect,if=buff.bloodlust.up|buff.icy_veins.up
actions.single_target
# count action,conditions
j 0.00 call_action_list,name=cooldowns,if=!talent.prismatic_crystal.enabled|cooldown.prismatic_crystal.remains>15
Single target sequence
k 0.01 ice_lance,if=buff.fingers_of_frost.react&buff.fingers_of_frost.remains<action.frostbolt.execute_time
Safeguards against losing FoF and BF to buff expiry
l 0.00 frostfire_bolt,if=buff.brain_freeze.react&buff.brain_freeze.remains<action.frostbolt.execute_time
m 0.00 frost_bomb,if=!talent.prismatic_crystal.enabled&cooldown.frozen_orb.remains<gcd.max&debuff.frost_bomb.remains<10
Frozen Orb usage without Prismatic Crystal
n 5.43 frozen_orb,if=!talent.prismatic_crystal.enabled&buff.fingers_of_frost.stack<2&cooldown.icy_veins.remains>45
o 0.00 frost_bomb,if=remains<action.ice_lance.travel_time&(buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&(talent.thermal_void.enabled|buff.fingers_of_frost.remains<gcd.max*2)))
Single target routine; Rough summary: IN2 > FoF2 > CmS > IN > BF > FoF
p 1.17 ice_nova,if=time_to_die<10|(charges=2&(!talent.prismatic_crystal.enabled|!cooldown.prismatic_crystal.up))
q 22.19 ice_lance,if=buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&dot.frozen_orb.ticking)
r 0.00 comet_storm
s 12.27 ice_nova,if=(!talent.prismatic_crystal.enabled|(charges=1&cooldown.prismatic_crystal.remains>recharge_time&buff.incanters_flow.stack>3))&(buff.icy_veins.up|(charges=1&cooldown.icy_veins.remains>recharge_time))
t 33.59 frostfire_bolt,if=buff.brain_freeze.react
u 0.00 ice_lance,if=set_bonus.tier17_4pc&talent.thermal_void.enabled&talent.mirror_image.enabled&dot.frozen_orb.ticking
v 0.00 ice_lance,if=talent.frost_bomb.enabled&buff.fingers_of_frost.react&debuff.frost_bomb.remains>travel_time&(!talent.thermal_void.enabled|cooldown.icy_veins.remains>8)
w 0.00 frostbolt,if=set_bonus.tier17_2pc&buff.ice_shard.up&!(talent.thermal_void.enabled&buff.icy_veins.up&buff.icy_veins.remains<10)
Camp procs and spam Frostbolt while 4T17 buff is up
x 26.79 ice_lance,if=!talent.frost_bomb.enabled&buff.fingers_of_frost.react&(!talent.thermal_void.enabled|cooldown.icy_veins.remains>8)
y 10.02 water_jet,if=buff.fingers_of_frost.react=0&!dot.frozen_orb.ticking
z 98.05 frostbolt
{ 0.00 ice_lance,moving=1

Sample Sequence

013678Xnpqq9szztzyzxxxzzttxzzzttqsxzztzztxyzzxxzzzttsxzzxznqzqqzzyzzxsx9zzzzttzzzzzttsxyzzxtxzzt9tzzDnqqszzqxyzzxxzztzzztsx9zzzyzzzqxzztzzzqXbstxnqzzzq9tyzzxxxszzzttzzttxzyzztxsxzzzttzzzDnqtzzstyzzqqtqtxz9zzzzzstxyzzqqxzzzzz

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 160000.0/160000: 100% mana
Pre food Fluffy_Pillow 160000.0/160000: 100% mana
Pre water_elemental Fluffy_Pillow 160000.0/160000: 100% mana
Pre mirror_image Fluffy_Pillow 160000.0/160000: 100% mana
Pre potion Fluffy_Pillow 160000.0/160000: 100% mana draenic_intellect_potion
0:00.000 frostbolt Fluffy_Pillow 153600.0/160000: 96% mana fingers_of_frost, mark_of_the_frostwolf, draenic_intellect_potion
0:00.000 icy_veins Fluffy_Pillow 153600.0/160000: 96% mana fingers_of_frost, mark_of_the_frostwolf, draenic_intellect_potion
0:00.000 frozen_orb Fluffy_Pillow 153600.0/160000: 96% mana fingers_of_frost, icy_veins, mark_of_the_frostwolf, draenic_intellect_potion
0:01.371 ice_nova Fluffy_Pillow 143227.9/160000: 90% mana bloodlust, fingers_of_frost(2), icy_veins, mark_of_the_frostwolf, draenic_intellect_potion
0:02.427 ice_lance Fluffy_Pillow 147562.7/160000: 92% mana bloodlust, fingers_of_frost(2), icy_veins, mark_of_the_frostwolf, draenic_intellect_potion
0:03.484 ice_lance Fluffy_Pillow 150301.7/160000: 94% mana bloodlust, fingers_of_frost, icy_veins, mark_of_the_frostwolf(2), draenic_intellect_potion
0:04.541 counterspell Fluffy_Pillow 153040.6/160000: 96% mana bloodlust, icy_veins, mark_of_the_frostwolf(2), draenic_intellect_potion
0:04.541 ice_nova Fluffy_Pillow 149840.6/160000: 94% mana bloodlust, icy_veins, mark_of_the_frostwolf(2), draenic_intellect_potion
0:05.600 frostbolt Fluffy_Pillow 154187.8/160000: 96% mana bloodlust, icy_veins, enhanced_frostbolt, mark_of_the_frostwolf(2), draenic_intellect_potion
0:06.657 frostbolt Fluffy_Pillow 152126.7/160000: 95% mana bloodlust, brain_freeze, icy_veins, mark_of_the_frostwolf(2), draenic_intellect_potion
0:08.063 frostfire_bolt Fluffy_Pillow 151498.3/160000: 95% mana bloodlust, brain_freeze, icy_veins, nightmare_fire, mark_of_the_frostwolf(2), draenic_intellect_potion
0:09.119 frostbolt Fluffy_Pillow 155833.1/160000: 97% mana bloodlust, icy_veins, nightmare_fire, draenic_intellect_potion
0:10.526 water_jet Fluffy_Pillow 155208.8/160000: 97% mana bloodlust, icy_veins, nightmare_fire, draenic_intellect_potion
0:10.526 frostbolt Fluffy_Pillow 155208.8/160000: 97% mana bloodlust, icy_veins, nightmare_fire, draenic_intellect_potion
0:11.933 ice_lance Fluffy_Pillow 154584.5/160000: 97% mana bloodlust, fingers_of_frost(2), icy_veins, nightmare_fire, draenic_intellect_potion
0:12.989 ice_lance Fluffy_Pillow 157319.3/160000: 98% mana bloodlust, fingers_of_frost(2), icy_veins, nightmare_fire, draenic_intellect_potion
0:14.044 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, fingers_of_frost, icy_veins, nightmare_fire, draenic_intellect_potion
0:15.099 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, icy_veins, nightmare_fire, draenic_intellect_potion
0:16.507 frostbolt Fluffy_Pillow 159379.8/160000: 100% mana bloodlust, brain_freeze, icy_veins, nightmare_fire, draenic_intellect_potion
0:17.914 frostfire_bolt Fluffy_Pillow 158755.5/160000: 99% mana bloodlust, brain_freeze(2), icy_veins, nightmare_fire, draenic_intellect_potion
0:18.971 frostfire_bolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, brain_freeze, fingers_of_frost, icy_veins, nightmare_fire, draenic_intellect_potion
0:20.028 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, fingers_of_frost, icy_veins, nightmare_fire, mark_of_the_frostwolf
0:21.085 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, icy_veins, nightmare_fire, mark_of_the_frostwolf
0:22.492 frostbolt Fluffy_Pillow 159375.7/160000: 100% mana bloodlust, icy_veins, enhanced_frostbolt, nightmare_fire, mark_of_the_frostwolf(2)
0:23.548 frostbolt Fluffy_Pillow 157310.5/160000: 98% mana bloodlust, brain_freeze, icy_veins, nightmare_fire, mark_of_the_frostwolf(2)
0:24.954 frostfire_bolt Fluffy_Pillow 156682.1/160000: 98% mana bloodlust, brain_freeze(2), icy_veins, nightmare_fire, mark_of_the_frostwolf(2)
0:26.010 frostfire_bolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, brain_freeze, fingers_of_frost, icy_veins, nightmare_fire, mark_of_the_frostwolf(2)
0:27.066 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, fingers_of_frost(2), icy_veins, nightmare_fire, mark_of_the_frostwolf(2)
0:28.122 ice_nova Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, fingers_of_frost, icy_veins, mark_of_the_frostwolf(2)
0:29.177 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, fingers_of_frost, icy_veins
0:30.230 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, icy_veins
0:31.637 frostbolt Fluffy_Pillow 159375.7/160000: 100% mana bloodlust, brain_freeze, icy_veins
0:33.044 frostfire_bolt Fluffy_Pillow 158751.4/160000: 99% mana bloodlust, brain_freeze, icy_veins
0:34.100 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, icy_veins
0:35.507 frostbolt Fluffy_Pillow 159375.7/160000: 100% mana bloodlust, brain_freeze, fingers_of_frost, icy_veins
0:36.914 frostfire_bolt Fluffy_Pillow 158751.4/160000: 99% mana bloodlust, brain_freeze, fingers_of_frost
0:37.971 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, fingers_of_frost
0:39.028 water_jet Fluffy_Pillow 160000.0/160000: 100% mana bloodlust
0:39.028 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, enhanced_frostbolt
0:40.085 frostbolt Fluffy_Pillow 157938.9/160000: 99% mana bloodlust
0:41.493 ice_lance Fluffy_Pillow 155984.9/160000: 97% mana fingers_of_frost
0:42.866 ice_lance Fluffy_Pillow 158720.4/160000: 99% mana fingers_of_frost
0:44.239 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
0:46.067 frostbolt Fluffy_Pillow 159372.2/160000: 100% mana
0:47.895 frostbolt Fluffy_Pillow 158744.4/160000: 99% mana brain_freeze, fingers_of_frost
0:49.724 frostfire_bolt Fluffy_Pillow 158119.8/160000: 99% mana brain_freeze(2), fingers_of_frost
0:51.096 frostfire_bolt Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze, fingers_of_frost
0:52.468 ice_nova Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost
0:53.841 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost
0:55.214 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana enhanced_frostbolt
0:56.587 frostbolt Fluffy_Pillow 157935.5/160000: 99% mana fingers_of_frost
0:58.415 ice_lance Fluffy_Pillow 157307.7/160000: 98% mana fingers_of_frost
0:59.788 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
1:01.617 frozen_orb Fluffy_Pillow 159375.4/160000: 100% mana
1:02.988 ice_lance Fluffy_Pillow 147704.5/160000: 92% mana fingers_of_frost
1:04.361 frostbolt Fluffy_Pillow 150440.0/160000: 94% mana
1:06.191 ice_lance Fluffy_Pillow 149818.5/160000: 94% mana fingers_of_frost(2)
1:07.564 ice_lance Fluffy_Pillow 152554.0/160000: 95% mana fingers_of_frost
1:08.937 frostbolt Fluffy_Pillow 155289.4/160000: 97% mana
1:10.767 frostbolt Fluffy_Pillow 154668.0/160000: 97% mana mark_of_the_frostwolf
1:12.595 water_jet Fluffy_Pillow 154040.2/160000: 96% mana mark_of_the_frostwolf
1:12.595 frostbolt Fluffy_Pillow 154040.2/160000: 96% mana enhanced_frostbolt, mark_of_the_frostwolf
1:13.967 frostbolt Fluffy_Pillow 151972.5/160000: 95% mana mark_of_the_frostwolf(2)
1:15.794 ice_lance Fluffy_Pillow 151341.5/160000: 95% mana fingers_of_frost, mark_of_the_frostwolf(2)
1:17.165 ice_nova Fluffy_Pillow 154070.7/160000: 96% mana fingers_of_frost, mark_of_the_frostwolf(2)
1:18.536 ice_lance Fluffy_Pillow 158399.8/160000: 99% mana fingers_of_frost, mark_of_the_frostwolf(2)
1:19.907 counterspell Fluffy_Pillow 160000.0/160000: 100% mana mark_of_the_frostwolf(2)
1:19.907 frostbolt Fluffy_Pillow 156800.0/160000: 98% mana mark_of_the_frostwolf(2)
1:21.734 frostbolt Fluffy_Pillow 156169.0/160000: 98% mana mark_of_the_frostwolf
1:23.563 frostbolt Fluffy_Pillow 155544.4/160000: 97% mana mark_of_the_frostwolf
1:25.391 frostbolt Fluffy_Pillow 154916.6/160000: 97% mana brain_freeze, mark_of_the_frostwolf
1:27.220 frostfire_bolt Fluffy_Pillow 154292.0/160000: 96% mana brain_freeze(2), mark_of_the_frostwolf
1:28.592 frostfire_bolt Fluffy_Pillow 158624.3/160000: 99% mana brain_freeze
1:29.964 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana enhanced_frostbolt
1:31.336 frostbolt Fluffy_Pillow 157932.3/160000: 99% mana
1:33.165 frostbolt Fluffy_Pillow 157307.7/160000: 98% mana
1:34.994 frostbolt Fluffy_Pillow 156683.0/160000: 98% mana
1:36.821 frostbolt Fluffy_Pillow 156052.1/160000: 98% mana brain_freeze, mark_of_the_frostwolf
1:38.650 frostfire_bolt Fluffy_Pillow 155427.4/160000: 97% mana brain_freeze(2), mark_of_the_frostwolf
1:40.022 frostfire_bolt Fluffy_Pillow 159759.8/160000: 100% mana brain_freeze, fingers_of_frost, mark_of_the_frostwolf
1:41.394 ice_nova Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost, mark_of_the_frostwolf
1:42.768 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost, mark_of_the_frostwolf(2)
1:44.140 water_jet Fluffy_Pillow 160000.0/160000: 100% mana mark_of_the_frostwolf(2)
1:44.140 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana mark_of_the_frostwolf(2)
1:45.969 frostbolt Fluffy_Pillow 159375.4/160000: 100% mana mark_of_the_frostwolf(2)
1:47.796 ice_lance Fluffy_Pillow 158744.4/160000: 99% mana brain_freeze, fingers_of_frost, mark_of_the_frostwolf(2)
1:49.169 frostfire_bolt Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze, fingers_of_frost, mark_of_the_frostwolf(2)
1:50.541 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost, mark_of_the_frostwolf(2)
1:51.913 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana enhanced_frostbolt, mark_of_the_frostwolf(2)
1:53.286 frostbolt Fluffy_Pillow 157935.5/160000: 99% mana brain_freeze, mark_of_the_frostwolf(2)
1:55.115 frostfire_bolt Fluffy_Pillow 157310.8/160000: 98% mana brain_freeze(2), mark_of_the_frostwolf(2)
1:56.487 counterspell Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze, mark_of_the_frostwolf(2)
1:56.487 frostfire_bolt Fluffy_Pillow 156800.0/160000: 98% mana brain_freeze, mark_of_the_frostwolf(2)
1:57.859 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana mark_of_the_frostwolf(2)
1:59.688 frostbolt Fluffy_Pillow 159375.4/160000: 100% mana
2:01.517 mirror_image Fluffy_Pillow 158750.7/160000: 99% mana fingers_of_frost
2:02.890 frozen_orb Fluffy_Pillow 159886.2/160000: 100% mana fingers_of_frost
2:04.262 ice_lance Fluffy_Pillow 148218.5/160000: 93% mana fingers_of_frost(2), mark_of_the_frostwolf
2:05.634 ice_lance Fluffy_Pillow 150950.8/160000: 94% mana fingers_of_frost, nightmare_fire, mark_of_the_frostwolf
2:07.008 ice_nova Fluffy_Pillow 153689.4/160000: 96% mana nightmare_fire, mark_of_the_frostwolf
2:08.381 frostbolt Fluffy_Pillow 158024.9/160000: 99% mana enhanced_frostbolt, nightmare_fire, mark_of_the_frostwolf
2:09.753 frostbolt Fluffy_Pillow 155957.2/160000: 97% mana fingers_of_frost, nightmare_fire, mark_of_the_frostwolf
2:11.581 ice_lance Fluffy_Pillow 155329.4/160000: 97% mana fingers_of_frost(2), nightmare_fire
2:12.953 ice_lance Fluffy_Pillow 158061.7/160000: 99% mana fingers_of_frost, nightmare_fire
2:14.324 water_jet Fluffy_Pillow 160000.0/160000: 100% mana nightmare_fire
2:14.324 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana nightmare_fire
2:16.153 frostbolt Fluffy_Pillow 159375.4/160000: 100% mana nightmare_fire, mark_of_the_frostwolf
2:17.981 ice_lance Fluffy_Pillow 158747.6/160000: 99% mana fingers_of_frost, nightmare_fire, mark_of_the_frostwolf
2:19.353 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost, nightmare_fire, mark_of_the_frostwolf
2:20.727 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana nightmare_fire, mark_of_the_frostwolf
2:22.556 frostbolt Fluffy_Pillow 159375.4/160000: 100% mana brain_freeze, nightmare_fire
2:24.385 frostfire_bolt Fluffy_Pillow 158750.7/160000: 99% mana brain_freeze
2:25.758 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana enhanced_frostbolt
2:27.131 frostbolt Fluffy_Pillow 157935.5/160000: 99% mana
2:28.960 frostbolt Fluffy_Pillow 157310.8/160000: 98% mana brain_freeze
2:30.788 frostfire_bolt Fluffy_Pillow 156683.0/160000: 98% mana brain_freeze, fingers_of_frost
2:32.160 ice_nova Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost
2:33.533 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost
2:34.906 counterspell Fluffy_Pillow 160000.0/160000: 100% mana mark_of_the_frostwolf
2:34.906 frostbolt Fluffy_Pillow 156800.0/160000: 98% mana mark_of_the_frostwolf(2)
2:36.734 frostbolt Fluffy_Pillow 156172.2/160000: 98% mana mark_of_the_frostwolf(2)
2:38.562 frostbolt Fluffy_Pillow 155544.4/160000: 97% mana mark_of_the_frostwolf(2)
2:40.393 water_jet Fluffy_Pillow 154926.1/160000: 97% mana mark_of_the_frostwolf(2)
2:40.393 frostbolt Fluffy_Pillow 154926.1/160000: 97% mana mark_of_the_frostwolf(2)
2:42.222 frostbolt Fluffy_Pillow 154301.4/160000: 96% mana enhanced_frostbolt
2:43.595 frostbolt Fluffy_Pillow 152236.9/160000: 95% mana fingers_of_frost
2:45.423 ice_lance Fluffy_Pillow 151609.1/160000: 95% mana fingers_of_frost(2)
2:46.794 ice_lance Fluffy_Pillow 154338.3/160000: 96% mana fingers_of_frost
2:48.166 frostbolt Fluffy_Pillow 157070.6/160000: 98% mana
2:49.993 frostbolt Fluffy_Pillow 156439.6/160000: 98% mana brain_freeze
2:51.821 frostfire_bolt Fluffy_Pillow 155811.8/160000: 97% mana brain_freeze, fingers_of_frost
2:53.193 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost
2:55.021 frostbolt Fluffy_Pillow 159372.2/160000: 100% mana fingers_of_frost
2:56.849 frostbolt Fluffy_Pillow 158744.4/160000: 99% mana fingers_of_frost(2)
2:58.676 ice_lance Fluffy_Pillow 158113.5/160000: 99% mana brain_freeze, fingers_of_frost(2)
3:00.048 icy_veins Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze, fingers_of_frost
3:00.048 potion Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze, fingers_of_frost, icy_veins
3:00.048 ice_nova Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze, fingers_of_frost, icy_veins, draenic_intellect_potion
3:01.420 frostfire_bolt Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze, fingers_of_frost, icy_veins, draenic_intellect_potion
3:02.793 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost, icy_veins, draenic_intellect_potion
3:04.166 frozen_orb Fluffy_Pillow 160000.0/160000: 100% mana icy_veins, draenic_intellect_potion
3:05.538 ice_lance Fluffy_Pillow 148332.3/160000: 93% mana fingers_of_frost, icy_veins, draenic_intellect_potion
3:06.911 frostbolt Fluffy_Pillow 151067.8/160000: 94% mana icy_veins, enhanced_frostbolt, draenic_intellect_potion
3:08.283 frostbolt Fluffy_Pillow 149000.1/160000: 93% mana icy_veins, draenic_intellect_potion
3:10.112 frostbolt Fluffy_Pillow 148375.5/160000: 93% mana brain_freeze, fingers_of_frost, icy_veins, draenic_intellect_potion
3:11.940 ice_lance Fluffy_Pillow 147747.7/160000: 92% mana brain_freeze, fingers_of_frost, icy_veins, draenic_intellect_potion
3:13.313 counterspell Fluffy_Pillow 150483.1/160000: 94% mana brain_freeze, icy_veins, draenic_intellect_potion
3:13.313 frostfire_bolt Fluffy_Pillow 147283.1/160000: 92% mana brain_freeze, icy_veins, draenic_intellect_potion
3:14.685 water_jet Fluffy_Pillow 151615.4/160000: 95% mana icy_veins, mark_of_the_frostwolf, draenic_intellect_potion
3:14.685 frostbolt Fluffy_Pillow 151615.4/160000: 95% mana icy_veins, mark_of_the_frostwolf, draenic_intellect_potion
3:16.514 frostbolt Fluffy_Pillow 150990.8/160000: 94% mana icy_veins, mark_of_the_frostwolf, draenic_intellect_potion
3:18.343 ice_lance Fluffy_Pillow 150366.2/160000: 94% mana fingers_of_frost(2), icy_veins, mark_of_the_frostwolf, draenic_intellect_potion
3:19.715 ice_lance Fluffy_Pillow 153098.5/160000: 96% mana fingers_of_frost(2), icy_veins, mark_of_the_frostwolf, draenic_intellect_potion
3:21.087 ice_lance Fluffy_Pillow 155830.8/160000: 97% mana fingers_of_frost, icy_veins, draenic_intellect_potion
3:22.457 ice_nova Fluffy_Pillow 158556.8/160000: 99% mana icy_veins, draenic_intellect_potion
3:23.830 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana icy_veins, enhanced_frostbolt, draenic_intellect_potion
3:25.203 frostbolt Fluffy_Pillow 157935.5/160000: 99% mana icy_veins
3:27.032 frostbolt Fluffy_Pillow 157310.8/160000: 98% mana brain_freeze, icy_veins
3:28.861 frostfire_bolt Fluffy_Pillow 156686.2/160000: 98% mana brain_freeze(2), icy_veins
3:30.232 frostfire_bolt Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze, icy_veins
3:31.604 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana icy_veins
3:33.430 frostbolt Fluffy_Pillow 159365.9/160000: 100% mana brain_freeze, fingers_of_frost
3:35.258 frostfire_bolt Fluffy_Pillow 158738.1/160000: 99% mana brain_freeze(2), fingers_of_frost
3:36.630 frostfire_bolt Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze, fingers_of_frost
3:38.002 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost
3:39.373 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
3:41.202 water_jet Fluffy_Pillow 159375.4/160000: 100% mana
3:41.202 frostbolt Fluffy_Pillow 159375.4/160000: 100% mana enhanced_frostbolt
3:42.574 frostbolt Fluffy_Pillow 157307.7/160000: 98% mana brain_freeze
3:44.403 frostfire_bolt Fluffy_Pillow 156683.0/160000: 98% mana brain_freeze, fingers_of_frost
3:45.776 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost(2)
3:47.151 ice_nova Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost
3:48.524 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost
3:49.899 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
3:51.729 frostbolt Fluffy_Pillow 159378.5/160000: 100% mana mark_of_the_frostwolf
3:53.558 frostbolt Fluffy_Pillow 158753.9/160000: 99% mana brain_freeze, mark_of_the_frostwolf
3:55.386 frostfire_bolt Fluffy_Pillow 158126.1/160000: 99% mana brain_freeze(2), mark_of_the_frostwolf(2)
3:56.758 frostfire_bolt Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze, mark_of_the_frostwolf(2)
3:58.130 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana enhanced_frostbolt, mark_of_the_frostwolf(2)
3:59.503 frostbolt Fluffy_Pillow 157935.5/160000: 99% mana mark_of_the_frostwolf(2)
4:01.331 frostbolt Fluffy_Pillow 157307.7/160000: 98% mana brain_freeze, mark_of_the_frostwolf(2)
4:03.159 mirror_image Fluffy_Pillow 156679.9/160000: 98% mana brain_freeze
4:04.529 frozen_orb Fluffy_Pillow 157805.9/160000: 99% mana brain_freeze
4:05.902 ice_lance Fluffy_Pillow 146141.3/160000: 91% mana brain_freeze, fingers_of_frost
4:07.275 frostfire_bolt Fluffy_Pillow 148876.8/160000: 93% mana brain_freeze, nightmare_fire
4:08.647 frostbolt Fluffy_Pillow 153209.1/160000: 96% mana nightmare_fire
4:10.476 frostbolt Fluffy_Pillow 152584.5/160000: 95% mana brain_freeze, nightmare_fire
4:12.303 ice_nova Fluffy_Pillow 151953.5/160000: 95% mana brain_freeze, nightmare_fire
4:13.674 frostfire_bolt Fluffy_Pillow 156282.7/160000: 98% mana brain_freeze, nightmare_fire
4:15.047 water_jet Fluffy_Pillow 160000.0/160000: 100% mana nightmare_fire
4:15.047 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana enhanced_frostbolt, nightmare_fire
4:16.419 frostbolt Fluffy_Pillow 157932.3/160000: 99% mana brain_freeze, fingers_of_frost, nightmare_fire
4:18.248 ice_lance Fluffy_Pillow 157307.7/160000: 98% mana brain_freeze(2), fingers_of_frost(2), nightmare_fire
4:19.621 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze(2), fingers_of_frost(2), nightmare_fire
4:20.994 frostfire_bolt Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze(2), fingers_of_frost, nightmare_fire
4:22.367 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze, fingers_of_frost(2), nightmare_fire
4:23.740 frostfire_bolt Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze, fingers_of_frost, nightmare_fire
4:25.112 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost, nightmare_fire
4:26.485 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana nightmare_fire
4:28.315 counterspell Fluffy_Pillow 159378.5/160000: 100% mana
4:28.315 frostbolt Fluffy_Pillow 156178.5/160000: 98% mana
4:30.142 frostbolt Fluffy_Pillow 155547.6/160000: 97% mana
4:31.969 frostbolt Fluffy_Pillow 154916.6/160000: 97% mana enhanced_frostbolt
4:33.341 frostbolt Fluffy_Pillow 152848.9/160000: 96% mana mark_of_the_frostwolf
4:35.167 frostbolt Fluffy_Pillow 152214.8/160000: 95% mana brain_freeze, mark_of_the_frostwolf
4:36.996 ice_nova Fluffy_Pillow 151590.2/160000: 95% mana brain_freeze, mark_of_the_frostwolf
4:38.368 frostfire_bolt Fluffy_Pillow 155922.5/160000: 97% mana brain_freeze, mark_of_the_frostwolf
4:39.739 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost
4:41.112 water_jet Fluffy_Pillow 160000.0/160000: 100% mana
4:41.112 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
4:42.941 frostbolt Fluffy_Pillow 159375.4/160000: 100% mana fingers_of_frost
4:44.767 ice_lance Fluffy_Pillow 158741.3/160000: 99% mana fingers_of_frost(2)
4:46.138 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost(2)
4:47.511 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost
4:48.886 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana enhanced_frostbolt
4:50.259 frostbolt Fluffy_Pillow 157935.5/160000: 99% mana
4:52.088 frostbolt Fluffy_Pillow 157310.8/160000: 98% mana mark_of_the_frostwolf
4:53.917 frostbolt Fluffy_Pillow 156686.2/160000: 98% mana mark_of_the_frostwolf
4:55.744 frostbolt Fluffy_Pillow 156055.2/160000: 98% mana mark_of_the_frostwolf

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 748 713 713
Agility 998 951 951
Stamina 4662 4239 4239
Intellect 4351 3881 3752 (2590)
Spirit 1157 1157 1157
Health 279720 254340 0
Mana 160000 160000 0
Spell Power 6317 5273 1392
Crit 15.84% 10.84% 642
Haste 9.64% 4.42% 442
Multistrike 37.36% 22.77% 1503
Damage / Heal Versatility 3.60% 0.60% 78
ManaReg per Second 3158 3007 0
Mastery 40.70% 30.70% 809
Armor 680 680 680
Run Speed 0 0 68

Talents

Level
15 Evanesce Blazing Speed Ice Floes
30 Alter Time Flameglow Ice Barrier
45 Ring of Frost Ice Ward Frostjaw
60 Greater Invisibility Cauterize Cold Snap
75 Frost Bomb (Frost Mage) Unstable Magic Ice Nova (Frost Mage)
90 Mirror Image Rune of Power Incanter's Flow
100 Thermal Void (Frost Mage) Prismatic Crystal Comet Storm (Frost Mage)

Profile

mage="Procrank"
origin="http://eu.battle.net/wow/en/character/forscherliga/Procrank/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/182/59746230-avatar.jpg"
level=100
race=draenei
role=spell
position=back
professions=tailoring=645/inscription=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#eb!2201200
glyphs=icy_veins/water_elemental/splitting_ice/unbound_elemental/illusion/rapid_teleportation
spec=frost

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_intellect_flask
actions.precombat+=/food,type=calamari_crepes
actions.precombat+=/arcane_brilliance
actions.precombat+=/water_elemental
actions.precombat+=/snapshot_stats
actions.precombat+=/rune_of_power
actions.precombat+=/mirror_image
actions.precombat+=/potion,name=draenic_intellect
actions.precombat+=/frostbolt

# Executed every time the actor is available.

actions=counterspell,if=target.debuff.casting.react
actions+=/blink,if=movement.distance>10
actions+=/blazing_speed,if=movement.remains>0
actions+=/time_warp,if=target.health.pct<25|time>5
actions+=/mirror_image
actions+=/ice_floes,if=buff.ice_floes.down&(raid_event.movement.distance>0|raid_event.movement.in<action.frostbolt.cast_time)
actions+=/rune_of_power,if=buff.rune_of_power.remains<cast_time
actions+=/rune_of_power,if=(cooldown.icy_veins.remains<gcd.max&buff.rune_of_power.remains<20)|(cooldown.prismatic_crystal.remains<gcd.max&buff.rune_of_power.remains<10)
actions+=/call_action_list,name=cooldowns,if=time_to_die<24
actions+=/call_action_list,name=crystal_sequence,if=talent.prismatic_crystal.enabled&(cooldown.prismatic_crystal.remains<=gcd.max|pet.prismatic_crystal.active)
actions+=/call_action_list,name=aoe,if=active_enemies>=4
actions+=/call_action_list,name=single_target

# Actions while Prismatic Crystal is active
actions.crystal_sequence=frost_bomb,if=active_enemies=1&current_target!=prismatic_crystal&remains<10
actions.crystal_sequence+=/frozen_orb
actions.crystal_sequence+=/call_action_list,name=cooldowns
actions.crystal_sequence+=/prismatic_crystal
actions.crystal_sequence+=/frost_bomb,if=talent.prismatic_crystal.enabled&current_target=prismatic_crystal&active_enemies>1&!ticking
actions.crystal_sequence+=/ice_lance,if=buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&active_dot.frozen_orb>=1)
actions.crystal_sequence+=/ice_nova,if=charges=2
actions.crystal_sequence+=/frostfire_bolt,if=buff.brain_freeze.react
actions.crystal_sequence+=/ice_lance,if=buff.fingers_of_frost.react
actions.crystal_sequence+=/ice_nova
actions.crystal_sequence+=/blizzard,interrupt_if=cooldown.frozen_orb.up|(talent.frost_bomb.enabled&buff.fingers_of_frost.react=2),if=active_enemies>=5
actions.crystal_sequence+=/frostbolt

# Consolidated damage cooldown abilities
actions.cooldowns=icy_veins
actions.cooldowns+=/blood_fury
actions.cooldowns+=/berserking
actions.cooldowns+=/arcane_torrent
actions.cooldowns+=/potion,name=draenic_intellect,if=buff.bloodlust.up|buff.icy_veins.up

# AoE sequence
actions.aoe=call_action_list,name=cooldowns
actions.aoe+=/frost_bomb,if=remains<action.ice_lance.travel_time&(cooldown.frozen_orb.remains<gcd.max|buff.fingers_of_frost.react=2)
actions.aoe+=/frozen_orb
actions.aoe+=/ice_lance,if=talent.frost_bomb.enabled&buff.fingers_of_frost.react&debuff.frost_bomb.up
actions.aoe+=/comet_storm
actions.aoe+=/ice_nova
actions.aoe+=/blizzard,interrupt_if=cooldown.frozen_orb.up|(talent.frost_bomb.enabled&buff.fingers_of_frost.react=2)

# Single target sequence
actions.single_target=call_action_list,name=cooldowns,if=!talent.prismatic_crystal.enabled|cooldown.prismatic_crystal.remains>15
# Safeguards against losing FoF and BF to buff expiry
actions.single_target+=/ice_lance,if=buff.fingers_of_frost.react&buff.fingers_of_frost.remains<action.frostbolt.execute_time
actions.single_target+=/frostfire_bolt,if=buff.brain_freeze.react&buff.brain_freeze.remains<action.frostbolt.execute_time
# Frozen Orb usage without Prismatic Crystal
actions.single_target+=/frost_bomb,if=!talent.prismatic_crystal.enabled&cooldown.frozen_orb.remains<gcd.max&debuff.frost_bomb.remains<10
actions.single_target+=/frozen_orb,if=!talent.prismatic_crystal.enabled&buff.fingers_of_frost.stack<2&cooldown.icy_veins.remains>45
# Single target routine; Rough summary: IN2 > FoF2 > CmS > IN > BF > FoF
actions.single_target+=/frost_bomb,if=remains<action.ice_lance.travel_time&(buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&(talent.thermal_void.enabled|buff.fingers_of_frost.remains<gcd.max*2)))
actions.single_target+=/ice_nova,if=time_to_die<10|(charges=2&(!talent.prismatic_crystal.enabled|!cooldown.prismatic_crystal.up))
actions.single_target+=/ice_lance,if=buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&dot.frozen_orb.ticking)
actions.single_target+=/comet_storm
actions.single_target+=/ice_nova,if=(!talent.prismatic_crystal.enabled|(charges=1&cooldown.prismatic_crystal.remains>recharge_time&buff.incanters_flow.stack>3))&(buff.icy_veins.up|(charges=1&cooldown.icy_veins.remains>recharge_time))
actions.single_target+=/frostfire_bolt,if=buff.brain_freeze.react
actions.single_target+=/ice_lance,if=set_bonus.tier17_4pc&talent.thermal_void.enabled&talent.mirror_image.enabled&dot.frozen_orb.ticking
actions.single_target+=/ice_lance,if=talent.frost_bomb.enabled&buff.fingers_of_frost.react&debuff.frost_bomb.remains>travel_time&(!talent.thermal_void.enabled|cooldown.icy_veins.remains>8)
# Camp procs and spam Frostbolt while 4T17 buff is up
actions.single_target+=/frostbolt,if=set_bonus.tier17_2pc&buff.ice_shard.up&!(talent.thermal_void.enabled&buff.icy_veins.up&buff.icy_veins.remains<10)
actions.single_target+=/ice_lance,if=!talent.frost_bomb.enabled&buff.fingers_of_frost.react&(!talent.thermal_void.enabled|cooldown.icy_veins.remains>8)
actions.single_target+=/water_jet,if=buff.fingers_of_frost.react=0&!dot.frozen_orb.ticking
actions.single_target+=/frostbolt
actions.single_target+=/ice_lance,moving=1

head=vilebreath_mask,id=113596,bonus_id=563,gems=50mult
neck=odyssian_choker,id=113833,bonus_id=566,enchant=75mult
shoulders=slaughterhouse_spaulders,id=113609,bonus_id=40/566
back=kyusys_tarflame_doomcloak,id=119346,bonus_id=42,enchant=gift_of_multistrike
chest=robes_of_necrotic_whispers,id=113655,bonus_id=566
shirt=sightless_mantle,id=98093
wrists=bracers_of_volatile_ice,id=114493,bonus_id=193
hands=meatmongers_gory_grips,id=113610
waist=cord_of_winsome_sorrows,id=119336,bonus_id=566
legs=seacursed_leggings,id=113828,bonus_id=566
feet=ironburner_sandals,id=118968,bonus_id=181
finger1=primal_gladiators_band_of_victory,id=115663,enchant=50mult
finger2=timeless_solium_band_of_the_archmage,id=118296,enchant=50mult
trinket1=sandmans_pouch,id=112320,bonus_id=525/529
trinket2=grandiose_power,id=114550
main_hand=rod_of_fel_nullification,id=113837,bonus_id=566,enchant=mark_of_the_frostwolf
off_hand=bileslingers_censer,id=113592,bonus_id=566

# Gear Summary
# gear_stamina=3349
# gear_intellect=2590
# gear_spell_power=1392
# gear_crit_rating=642
# gear_haste_rating=442
# gear_mastery_rating=809
# gear_armor=680
# gear_multistrike_rating=1431
# gear_versatility_rating=78
# gear_speed_rating=68
# gear_avoidance_rating=104

Zentimeter

Zentimeter : 24177 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
24176.6 24176.6 11.2 / 0.046% 3443.1 / 14.2% 6.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
2833.6 2833.6 Mana 0.00% 44.7 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Zentimeter/advanced
Talents
  • 15: Ice Floes
  • 30: Ice Barrier
  • 45: Ring of Frost
  • 60: Cauterize
  • 75: Ice Nova (Frost Mage)
  • 90: Mirror Image
  • 100: Thermal Void (Frost Mage)
  • Talent Calculator
Glyphs
  • Glyph of Icy Veins
  • Glyph of Splitting Ice
  • Glyph of Water Elemental
  • Glyph of Conjure Familiar
  • Glyph of Evaporation
  • Glyph of Momentum
Professions
  • tailoring: 685
  • enchanting: 690

Charts

http://6.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Zentimeter+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x210&chd=t:374204|36309|35719|33026|20297|11017&chds=0,748408&chco=69CCF0,9900CC,0070DE,0070DE,0070DE,0070DE&chm=t++374204++mirror_image,69CCF0,0,0,15|t++36309++frostfire_bolt,9900CC,1,0,15|t++35719++ice_nova,0070DE,2,0,15|t++33026++frozen_orb,0070DE,3,0,15|t++20297++ice_lance,0070DE,4,0,15|t++11017++frostbolt,0070DE,5,0,15& http://7.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Zentimeter+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:24,23,19,19,11,11,11,8,4,2&chds=0,100&chdls=ffffff&chco=0070DE,0070DE,9900CC,0070DE,0070DE,0070DE,0070DE,9900CC,0070DE,0070DE&chl=ice_lance|frostbolt|frostfire_bolt|mirror_image: frostbolt|water_elemental: waterbolt|ice_nova|icicle_fb|icicle_ffb|frozen_orb_bolt|water_elemental: water_jet&
http://9.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Zentimeter+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:ehknruwz2465842343220zzxvtttrrqpnnlkhfdccbbZZXWVUTSRRSSSSTTTTTSSSSUVVVVVUUTTTSSSSRRRRRQPPPPQRSSSSSSSSSSSSSSSSSSRPPQRSUVVWXXYZZaabcddeeedcbaaabbbbbaaZZZZZZYYYYYYXWVUUTTSSSTTTTTUVWWXXYZabcdeefefghhgffeeedccbbbaZZYWUUUTUVVVUUUTTTSSSSSSSRRSRRSSTUWXYYZaabccdeeeeddccbaZZZabaaZZZZYYYYYYXXXWWVUSSSSSTSSSSSSSSSSTTTTTUUUTTTTTUUUTTSSSRRRRRRRRRQRRQPQQRRSSSSSSSSSSSRSSSSTUUUUUTTSRQPPONM&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.436683,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=24177|max=55364&chxp=1,1,44,100 http://2.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Zentimeter+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,0,0,5,12,18,20,54,104,151,262,334,487,656,762,851,986,1124,1156,1339,1381,1361,1465,1496,1463,1353,1327,1226,1126,945,876,694,575,420,276,245,153,115,71,51,29,16,7,4,1,1,0,0,0,1&chds=0,1496&chbh=5&chxt=x&chxl=0:|min=20921|avg=24177|max=28013&chxp=0,1,46,100& http://8.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Zentimeter+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:56.2,21.3,13.3,5.7,2.4,0.9&chds=0,100&chdls=ffffff&chco=0070DE,0070DE,9900CC,0070DE,0070DE,69CCF0&chl=frostbolt 169.2s|ice_lance 64.2s|frostfire_bolt 40.1s|ice_nova 17.2s|frozen_orb 7.3s|mirror_image 2.7s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Zentimeter 24177
frostbolt 4245 (6204) 17.6% (25.7%) 102.7 2.90sec 18147 11017 Direct 102.5 8819 17795 9932 12.4% 84.4 2697 5474 12.9%  

Stats details: frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 102.72 102.48 0.00 0.00 1.6472 0.0000 1275776.22 1275776.22 0.00 11016.84 11016.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 10.90 12.91% 5473.70 5162 6297 5477.74 0 6297 59668 59668 0.00
multistrike 73.51 87.09% 2697.22 2581 3149 2698.77 2611 2802 198268 198268 0.00
hit 89.77 87.60% 8819.35 8603 10496 8822.99 8660 9015 791705 791705 0.00
crit 12.71 12.40% 17795.33 17207 20991 17806.99 17207 20991 226135 226135 0.00
 
DPS Timeline Chart
 

Action details: frostbolt

Static Values
  • id:116
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6400.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:$?$w1=0[][Movement slowed by $w1%.]
  • description:Launches a bolt of frost at the enemy, causing {$s2=1310} Frost damage and slowing movement speed by {$s1=50}% for {$d=15 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.191000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    icicle_fb 1959 8.1% 184.8 1.96sec 3183 0 Direct 183.7 3203 0 3203 0.0% 0.0 0 0 0.0%  

Stats details: icicle_fb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 184.80 183.69 0.00 0.00 0.0000 0.0000 588284.85 588284.85 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 183.69 100.00% 3202.59 1142 15559 3204.94 2473 4221 588285 588285 0.00
 
DPS Timeline Chart
 

Action details: icicle

Static Values
  • id:148022
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:148022
  • name:Icicle
  • school:frost
  • tooltip:
  • description:{$@spelldesc76613=When you damage enemies with Frostbolt and Frostfire Bolt, and their multistrikes, {$s1=0}% of the damage done is stored as an Icicle with you, for {$148012d=30 seconds}. Also increases the damage of your Water Elemental's Waterbolt by {$s3=0}%. Up to {$s2=5} Icicles can be stored at once. Casting Ice Lance causes any Icicles to begin launching at the target.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3634.05
  • base_dd_max:3634.05
 
frostfire_bolt 3418 (4856) 14.1% (20.1%) 31.2 9.39sec 46563 36309 Direct 31.2 14881 30063 25415 69.4% 29.5 4564 9252 70.2%  

Stats details: frostfire_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.24 31.18 0.00 0.00 1.2824 0.0000 1024132.63 1024132.63 0.00 36308.60 36308.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 20.70 70.18% 9252.24 8646 10548 9259.69 8646 10276 191544 191544 0.00
multistrike 8.80 29.82% 4563.62 4323 5274 4566.60 0 5274 40140 40140 0.00
hit 9.55 30.62% 14881.12 14410 17580 14888.67 0 17580 142066 142066 0.00
crit 21.63 69.38% 30062.69 28821 35161 30086.27 28821 32443 650382 650382 0.00
 
DPS Timeline Chart
 

Action details: frostfire_bolt

Static Values
  • id:44614
  • school:frostfire
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6400.0
  • cooldown:0.000
  • base_execute_time:2.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.brain_freeze.react
Spelldata
  • id:44614
  • name:Frostfire Bolt
  • school:frostfire
  • tooltip:Movement slowed by {$s1=40}%.
  • description:Launches a bolt of frostfire at the enemy, causing $?a57761[${$m2*1.25} to ${$M2*1.25}][{$s2=1743}] Frostfire damage and slowing the target's movement by {$s1=40}% for {$d=8 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.586000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    icicle_ffb 1437 5.9% 60.0 5.14sec 7171 0 Direct 59.7 7207 0 7207 0.0% 0.0 0 0 0.0%  

Stats details: icicle_ffb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.04 59.75 0.00 0.00 0.0000 0.0000 430607.78 430607.78 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.75 100.00% 7207.18 1142 15559 7219.46 5370 9598 430608 430608 0.00
 
DPS Timeline Chart
 

Action details: icicle

Static Values
  • id:148022
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:148022
  • name:Icicle
  • school:frost
  • tooltip:
  • description:{$@spelldesc76613=When you damage enemies with Frostbolt and Frostfire Bolt, and their multistrikes, {$s1=0}% of the damage done is stored as an Icicle with you, for {$148012d=30 seconds}. Also increases the damage of your Water Elemental's Waterbolt by {$s3=0}%. Up to {$s2=5} Icicles can be stored at once. Casting Ice Lance causes any Icicles to begin launching at the target.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3634.05
  • base_dd_max:3634.05
 
frozen_orb 0 (809) 0.0% (3.3%) 5.4 61.07sec 44600 33026

Stats details: frozen_orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.43 5.43 53.24 53.24 1.3505 1.0000 0.00 0.00 0.00 3997.99 33026.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.43 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.0 84.48% 0.00 0 0 0.00 0 0 0 0 0.00
crit 8.3 15.52% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: frozen_orb

Static Values
  • id:84714
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:16000.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:84714
  • name:Frozen Orb
  • school:frost
  • tooltip:
  • description:Launches a Frozen Orb forward from the Mage's position, releasing Frostbolts that deal {$84721s2=422} Frost damage to all nearby enemy targets for {$d=10 seconds}. Grants the Mage 1 charge of Fingers of Frost when it first reaches a target. Targets damaged by the Frost Orb are slowed by {$84721s1=30}% for {$84721d=2 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    frozen_orb_bolt 809 3.3% 0.0 0.00sec 0 0 Direct 53.2 2999 5986 3461 15.5% 53.4 939 1875 15.4%  

Stats details: frozen_orb_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 53.24 0.00 0.00 0.0000 0.0000 242182.17 242182.17 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 8.22 15.38% 1875.23 1662 2027 1876.32 0 2027 15412 15412 0.00
multistrike 45.22 84.62% 939.39 831 1013 940.54 889 1002 42474 42474 0.00
hit 45.00 84.52% 2998.97 2769 3378 3002.83 2900 3168 134959 134959 0.00
crit 8.24 15.48% 5986.35 5539 6757 5991.74 0 6757 49337 49337 0.00
 
DPS Timeline Chart
 

Action details: frozen_orb_bolt

Static Values
  • id:84721
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:84721
  • name:Frozen Orb
  • school:frost
  • tooltip:Movement slowed by {$s1=30}%.
  • description:{$@spelldesc84714=Launches a Frozen Orb forward from the Mage's position, releasing Frostbolts that deal {$84721s2=422} Frost damage to all nearby enemy targets for {$d=10 seconds}. Grants the Mage 1 charge of Fingers of Frost when it first reaches a target. Targets damaged by the Frost Orb are slowed by {$84721s1=30}% for {$84721d=2 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.383250
  • base_dd_min:1.00
  • base_dd_max:1.00
 
ice_lance 4341 18.0% 49.4 6.05sec 26386 20297 Direct 49.2 12077 24291 20644 70.1% 44.6 3741 7545 70.7%  

Stats details: ice_lance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.39 49.22 0.00 0.00 1.3000 0.0000 1303176.94 1303176.94 0.00 20296.81 20296.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 31.57 70.74% 7545.13 6934 8459 7552.31 7068 8205 238163 238163 0.00
multistrike 13.06 29.26% 3740.96 3467 4229 3744.67 3467 4229 48848 48848 0.00
hit 14.70 29.86% 12076.77 11556 14098 12086.48 11556 13463 177496 177496 0.00
crit 34.53 70.14% 24290.62 23112 28196 24310.69 23266 25756 838670 838670 0.00
 
DPS Timeline Chart
 

Action details: ice_lance

Static Values
  • id:30455
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1600.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&active_dot.frozen_orb>=1)
Spelldata
  • id:30455
  • name:Ice Lance
  • school:frost
  • tooltip:
  • description:Deals $?a44544[${$m1*$<fingersMult>} to ${$M1*$<fingersMult>}][{$s1=440}] Frost damage to an enemy target{$?s56377=true}&!a44544[, and ${$m1*$56377m2/100} to ${$M1*$56377m2/100} Frost damage to a second nearby target][]{$?s56377=true}&a44544[, and ${$m1*$<fingersMult>*$56377m2/100} to ${$M1*$<fingersMult>*$56377m2/100} Frost damage to a second nearby target][]. Ice Lance damage is doubled against frozen targets. Replaces Fire Blast.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
ice_nova 2053 8.5% 13.4 23.09sec 45769 35719 Direct 13.4 30761 61858 34811 13.0% 13.6 9569 19254 13.2%  

Stats details: ice_nova

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.45 13.45 0.00 0.00 1.2813 0.0000 615446.93 615446.93 0.00 35719.50 35719.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.80 13.24% 19254.16 17336 21149 16297.20 0 21149 34603 34603 0.00
multistrike 11.78 86.76% 9569.25 8668 10574 9588.72 8668 10574 112741 112741 0.00
hit 11.70 86.98% 30760.87 28893 35248 30786.63 28893 33130 359762 359762 0.00
crit 1.75 13.02% 61858.33 57785 70496 52397.43 0 70496 108340 108340 0.00
 
DPS Timeline Chart
 

Action details: ice_nova

Static Values
  • id:157997
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:25.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=2
Spelldata
  • id:157997
  • name:Ice Nova
  • school:frost
  • tooltip:Frozen.
  • description:Causes a whirl of icy wind around the target enemy or ally, dealing {$s2=2199} Frost damage to all enemies within $A2 yards, and freezing for {$d=2 seconds}. A primary enemy target will take {$s1=100}% increased damage. Max 2 charges. Replaces Frost Nova.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
mirror_image 0 (3390) 0.0% (14.0%) 3.0 120.73sec 337283 374204

Stats details: mirror_image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 0.9015 0.0000 0.00 0.00 0.00 374203.85 374203.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.61 86.90% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.39 13.10% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: mirror_image

Static Values
  • id:55342
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3200.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:
  • description:Creates {$s2=3} copies of the caster nearby, which cast spells and attack the Mage's enemies. Lasts {$55342d=40 seconds}.
 
    frostbolt (mirror_image) 9106 14.0% 201.9 4.06sec 5024 3084 Direct 200.9 3315 6739 3882 16.5% 194.8 1021 2089 17.1%  

Stats details: frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 201.94 200.95 0.00 0.00 1.6289 0.0000 1014466.64 1014466.64 0.00 3083.94 3083.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 33.28 17.09% 2089.13 1907 2326 2090.50 1921 2271 69533 69533 0.00
multistrike 161.50 82.91% 1021.28 953 1163 1021.95 996 1072 164937 164937 0.00
hit 167.70 83.45% 3315.05 3178 3877 3317.24 3268 3404 555918 555918 0.00
crit 33.25 16.55% 6738.56 6356 7754 6745.07 6356 7328 224079 224079 0.00
 
DPS Timeline Chart
 

Action details: frostbolt

Static Values
  • id:59638
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.550000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - water_elemental 2524 / 2524
water_jet 429 1.8% 10.0 30.38sec 12916 3029 Periodic 39.7 2266 4581 2578 13.5% 33.2 704 1429 14.1% 11.3%

Stats details: water_jet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.99 9.99 39.69 39.69 4.2637 0.8576 129043.46 129043.46 0.00 3029.26 3029.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 4.7 14.10% 1428.72 1304 1590 1419.38 0 1590 6681 6681 0.00
multistrike 28.5 85.90% 703.61 652 795 704.69 670 768 20047 20047 0.00
hit 34.3 86.53% 2265.79 2173 2651 2267.51 2200 2339 77816 77816 0.00
crit 5.3 13.47% 4580.71 4346 5302 4565.31 0 5302 24499 24499 0.00
 
DPS Timeline Chart
 

Action details: water_jet

Static Values
  • id:135029
  • school:frost
  • resource:none
  • range:45.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:25.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:135029
  • name:Water Jet
  • school:frost
  • tooltip:Taking {$s1=0} damage every $t1 sec. Frostbolts from the Water Elemental's owner that hit the target will grant a charge of Fingers of Frost.
  • description:Channels a jet of icy water at the target, dealing $o1 Frost damage to the target over {$d=4 seconds}. The Mage's Frostbolts that hit the target while it is being blasted with icy water will grant a charge of Fingers of Frost.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.282000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
waterbolt 2094 8.7% 114.5 2.62sec 5490 2535 Direct 113.6 3854 7776 4351 12.7% 100.1 1184 2399 13.1%  

Stats details: waterbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 114.55 113.62 0.00 0.00 2.1658 0.0000 628857.02 628857.02 0.00 2534.87 2534.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 13.11 13.09% 2399.17 2242 2735 2401.36 2242 2735 31462 31462 0.00
multistrike 87.03 86.91% 1184.32 1121 1368 1185.10 1143 1236 103072 103072 0.00
hit 99.23 87.34% 3854.12 3737 4559 3856.01 3787 3929 382458 382458 0.00
crit 14.39 12.66% 7776.14 7474 9118 7781.44 7474 8844 111864 111864 0.00
 
DPS Timeline Chart
 

Action details: waterbolt

Static Values
  • id:31707
  • school:frost
  • resource:none
  • range:45.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:31707
  • name:Waterbolt
  • school:frost
  • tooltip:
  • description:Deals {$s1=533} Frost damage to the target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.485000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - mirror_image 9106 / 3390
frostbolt 9106 14.0% 201.9 4.06sec 5024 3084 Direct 200.9 3315 6739 3882 16.5% 194.8 1021 2089 17.1%  

Stats details: frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 201.94 200.95 0.00 0.00 1.6289 0.0000 1014466.64 1014466.64 0.00 3083.94 3083.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 33.28 17.09% 2089.13 1907 2326 2090.50 1921 2271 69533 69533 0.00
multistrike 161.50 82.91% 1021.28 953 1163 1021.95 996 1072 164937 164937 0.00
hit 167.70 83.45% 3315.05 3178 3877 3317.24 3268 3404 555918 555918 0.00
crit 33.25 16.55% 6738.56 6356 7754 6745.07 6356 7328 224079 224079 0.00
 
DPS Timeline Chart
 

Action details: frostbolt

Static Values
  • id:59638
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.550000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Zentimeter
counterspell 7.2 43.22sec

Stats details: counterspell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.19 7.19 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.19 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: counterspell

Static Values
  • id:2139
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:3200.0
  • cooldown:24.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.debuff.casting.react
Spelldata
  • id:2139
  • name:Counterspell
  • school:arcane
  • tooltip:
  • description:Counters the enemy's spellcast, preventing any spell from that school of magic from being cast for {$d=6 seconds}$?s12598[ and silencing the target for $55021d.][.]
 
draenic_intellect_potion 2.0 0.00sec

Stats details: draenic_intellect_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156426
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156426
  • name:Draenic Intellect Potion
  • school:physical
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
 
icy_veins 2.1 181.22sec

Stats details: icy_veins

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.06 2.06 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.83 88.72% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.23 11.28% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: icy_veins

Static Values
  • id:12472
  • school:frost
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:12472
  • name:Icy Veins
  • school:frost
  • tooltip:$?$w3>0[Multistrike chance increased by $w3%][Haste increased by $w1%] and immune to pushback.
  • description:Accelerates your spellcasting, granting {$?s56364=true}[{$s3=0}% multistrike chance][$m1% haste] and preventing spell pushback.$?s56374[ Casting Icy Veins removes all movement slowing and cast time slowing effects.][] Lasts {$d=20 seconds}.
 
water_elemental 1.0 0.00sec

Stats details: water_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.90 89.62% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.10 10.38% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: water_elemental

Static Values
  • id:31687
  • school:frost
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:4800.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:31687
  • name:Summon Water Elemental
  • school:frost
  • tooltip:
  • description:Summons a Water Elemental to fight for the caster.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 33.34% 0.0(0.0)

Buff details

  • buff initial source:Zentimeter
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
brain_freeze 25.3 6.2 11.8sec 9.4sec 20.48% 100.00% 0.0(0.0)

Buff details

  • buff initial source:Zentimeter
  • cooldown name:buff_brain_freeze
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • brain_freeze_1:19.81%
  • brain_freeze_2:0.67%

Trigger Attempt Success

  • trigger_pct:30.83%

Spelldata details

  • id:57761
  • name:Brain Freeze
  • tooltip:Your next Frostfire Bolt costs no mana, is instant cast, acts as if your target were frozen, and deals {$44549s3=85}% additional damage.
  • description:{$@spelldesc44549=Your Frostbolts have a $m1% chance to cause the Brain Freeze effect. Each multistrike increases that cast's chance by an additional $m2%. The Brain Freeze effect causes your next Frostfire Bolt to cost no mana, be instant cast, deal {$s3=85}% additional damage, and act as if your target were frozen.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
draenic_intellect_potion 2.0 0.0 180.8sec 0.0sec 15.21% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Zentimeter
  • cooldown name:buff_draenic_intellect_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:1000.00

Stack Uptimes

  • draenic_intellect_potion_1:15.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156426
  • name:Draenic Intellect Potion
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
enhanced_frostbolt 17.5 0.0 17.7sec 18.4sec 7.10% 17.01% 0.0(0.0)

Buff details

  • buff initial source:Zentimeter
  • cooldown name:buff_enhanced_frostbolt
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • enhanced_frostbolt_1:7.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:157646
  • name:Enhanced Frostbolt
  • tooltip:
  • description:Frostbolt's cast time is reduced by 0.5 sec. This effect is disabled for {$157648d=15 seconds} after you benefit from it.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
fingers_of_frost 35.2 16.4 8.6sec 5.9sec 30.57% 100.00% 1.9(1.9)

Buff details

  • buff initial source:Zentimeter
  • cooldown name:buff_fingers_of_frost
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • fingers_of_frost_1:26.18%
  • fingers_of_frost_2:4.39%

Trigger Attempt Success

  • trigger_pct:24.63%

Spelldata details

  • id:44544
  • name:Fingers of Frost
  • tooltip:Your next Ice Lance or Deep Freeze act as if your target were frozen and Ice Lance deals $w2% more damage.
  • description:{$@spelldesc112965=Your successful Frostbolts, Frostfire Bolts and Frozen Orb hits have a {$s1=15}% chance, and your Blizzard ticks have a {$s2=5}% chance to grant you the Fingers of Frost effect. The Fingers of Frost effect causes your next Ice Lance or Deep Freeze to act as if your target were frozen, and increases Ice Lance damage by {$44544s2=100}%. Limit {$44544s1=2} charges.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
icy_veins 2.1 0.0 180.8sec 181.2sec 22.63% 24.38% 0.0(0.0)

Buff details

  • buff initial source:Zentimeter
  • cooldown name:buff_icy_veins
  • max_stacks:1
  • duration:20.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • icy_veins_1:22.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:12472
  • name:Icy Veins
  • tooltip:$?$w3>0[Multistrike chance increased by $w3%][Haste increased by $w1%] and immune to pushback.
  • description:Accelerates your spellcasting, granting {$?s56364=true}[{$s3=0}% multistrike chance][$m1% haste] and preventing spell pushback.$?s56374[ Casting Icy Veins removes all movement slowing and cast time slowing effects.][] Lasts {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
mark_of_the_frostwolf 13.6 4.1 22.7sec 17.2sec 31.36% 31.37% 0.9(0.9)

Buff details

  • buff initial source:Zentimeter
  • cooldown name:buff_mark_of_the_frostwolf
  • max_stacks:2
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stat Buff details

  • stat:multistrike_rating
  • amount:500.00

Stack Uptimes

  • mark_of_the_frostwolf_1:24.11%
  • mark_of_the_frostwolf_2:7.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:159676
  • name:Mark of the Frostwolf
  • tooltip:Multistrike increased by $w1.
  • description:Increases multistrike by {$s1=500}.
  • max_stacks:2
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
nightmare_fire 3.0 0.0 121.4sec 121.3sec 19.00% 19.01% 0.0(0.0)

Buff details

  • buff initial source:Zentimeter
  • cooldown name:buff_nightmare_fire
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:crit_rating
  • amount:1396.00

Stack Uptimes

  • nightmare_fire_1:19.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162919
  • name:Nightmare Fire
  • tooltip:Critical strike increased by {$s1=1044}.
  • description:Critical strike increased by {$s1=1044} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
frost_armor

Buff details

  • buff initial source:Zentimeter
  • cooldown name:buff_frost_armor
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • frost_armor_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:7302
  • name:Frost Armor
  • tooltip:Multistrike increased by $7302w1%. Attackers are slowed.
  • description:Increases multistrike chance by {$s1=8}% and causes enemies who strike the caster to be slowed by {$7321s2=30}% for {$7321d=5 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
greater_draenic_intellect_flask

Buff details

  • buff initial source:Zentimeter
  • cooldown name:buff_greater_draenic_intellect_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:250.00

Stack Uptimes

  • greater_draenic_intellect_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156079
  • name:Greater Draenic Intellect Flask
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Zentimeter
counterspell Mana 7.2 22994.6 3200.0 3200.0 0.0
frostbolt Mana 102.7 657389.6 6400.0 6400.0 2.8
frozen_orb Mana 5.4 86880.8 16000.0 15999.8 2.8
ice_lance Mana 49.4 79022.2 1600.0 1600.0 16.5
mirror_image Mana 3.0 6424.8 2136.1 2136.1 157.9
Resource Gains Type Count Total Average Overflow
external_healing Health 7.97 0.00 (0.00%) 0.00 75079.22 100.00%
mp5_regen Mana 202.79 848473.43 (100.00%) 4184.04 153112.85 15.29%
Resource RPS-Gain RPS-Loss
Mana 2819.47 2833.55
Combat End Resource Mean Min Max
Mana 163766.94 143467.83 168000.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
water_elemental 100.0%
water_elemental-water_elemental 100.0%
prismatic_crystal-water_elemental 100.0%
mirror_image-water_elemental 100.0%
mirror_image-water_elemental 100.0%
mirror_image-water_elemental 100.0%
Uptimes %
Mana Cap 18.5%
water_elemental-Mana Cap 18.5%
prismatic_crystal-Mana Cap 18.5%
mirror_image-Mana Cap 18.5%
mirror_image-Mana Cap 18.5%
mirror_image-Mana Cap 18.5%

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Zentimeter Fight Length
Count 25000
Mean 300.94
Minimum 230.43
Maximum 374.11
Spread ( max - min ) 143.68
Range [ ( max - min ) / 2 * 100% ] 23.87%
DPS
Sample Data Zentimeter Damage Per Second
Count 25000
Mean 24176.57
Minimum 20921.29
Maximum 28013.19
Spread ( max - min ) 7091.90
Range [ ( max - min ) / 2 * 100% ] 14.67%
Standard Deviation 901.2954
5th Percentile 22710.25
95th Percentile 25644.82
( 95th Percentile - 5th Percentile ) 2934.57
Mean Distribution
Standard Deviation 5.7003
95.00% Confidence Intervall ( 24165.40 - 24187.74 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5338
0.1 Scale Factor Error with Delta=300 6934
0.05 Scale Factor Error with Delta=300 27738
0.01 Scale Factor Error with Delta=300 693454
Distribution Chart
DPS(e)
Sample Data Zentimeter Damage Per Second (Effective)
Count 25000
Mean 24176.57
Minimum 20921.29
Maximum 28013.19
Spread ( max - min ) 7091.90
Range [ ( max - min ) / 2 * 100% ] 14.67%
Damage
Sample Data Zentimeter Damage
Count 25000
Mean 5479607.52
Minimum 3991005.42
Maximum 7223753.73
Spread ( max - min ) 3232748.31
Range [ ( max - min ) / 2 * 100% ] 29.50%
DTPS
Sample Data Zentimeter Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Zentimeter Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Zentimeter Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Zentimeter Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Zentimeter Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Zentimeter Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data ZentimeterTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Zentimeter Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_intellect_flask
1 0.00 food,type=calamari_crepes
2 0.00 arcane_brilliance
3 0.00 water_elemental
4 0.00 snapshot_stats
5 0.00 rune_of_power
6 0.00 mirror_image
7 0.00 potion,name=draenic_intellect
8 0.00 frostbolt
Default action list Executed every time the actor is available.
# count action,conditions
9 7.19 counterspell,if=target.debuff.casting.react
A 0.00 blink,if=movement.distance>10
B 0.00 blazing_speed,if=movement.remains>0
C 0.00 time_warp,if=target.health.pct<25|time>5
D 2.01 mirror_image
E 0.00 ice_floes,if=buff.ice_floes.down&(raid_event.movement.distance>0|raid_event.movement.in<action.frostbolt.cast_time)
F 0.00 rune_of_power,if=buff.rune_of_power.remains<cast_time
G 0.00 rune_of_power,if=(cooldown.icy_veins.remains<gcd.max&buff.rune_of_power.remains<20)|(cooldown.prismatic_crystal.remains<gcd.max&buff.rune_of_power.remains<10)
H 0.00 call_action_list,name=cooldowns,if=time_to_die<24
I 0.00 call_action_list,name=crystal_sequence,if=talent.prismatic_crystal.enabled&(cooldown.prismatic_crystal.remains<=gcd.max|pet.prismatic_crystal.active)
J 0.00 call_action_list,name=aoe,if=active_enemies>=4
K 0.00 call_action_list,name=single_target
actions.cooldowns
# count action,conditions
X 2.06 icy_veins
Consolidated damage cooldown abilities
Y 0.00 blood_fury
Z 0.00 berserking
a 0.00 arcane_torrent
b 1.00 potion,name=draenic_intellect,if=buff.bloodlust.up|buff.icy_veins.up
actions.single_target
# count action,conditions
j 0.00 call_action_list,name=cooldowns,if=!talent.prismatic_crystal.enabled|cooldown.prismatic_crystal.remains>15
Single target sequence
k 0.01 ice_lance,if=buff.fingers_of_frost.react&buff.fingers_of_frost.remains<action.frostbolt.execute_time
Safeguards against losing FoF and BF to buff expiry
l 0.00 frostfire_bolt,if=buff.brain_freeze.react&buff.brain_freeze.remains<action.frostbolt.execute_time
m 0.00 frost_bomb,if=!talent.prismatic_crystal.enabled&cooldown.frozen_orb.remains<gcd.max&debuff.frost_bomb.remains<10
Frozen Orb usage without Prismatic Crystal
n 5.43 frozen_orb,if=!talent.prismatic_crystal.enabled&buff.fingers_of_frost.stack<2&cooldown.icy_veins.remains>45
o 0.00 frost_bomb,if=remains<action.ice_lance.travel_time&(buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&(talent.thermal_void.enabled|buff.fingers_of_frost.remains<gcd.max*2)))
Single target routine; Rough summary: IN2 > FoF2 > CmS > IN > BF > FoF
p 1.17 ice_nova,if=time_to_die<10|(charges=2&(!talent.prismatic_crystal.enabled|!cooldown.prismatic_crystal.up))
q 22.07 ice_lance,if=buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&dot.frozen_orb.ticking)
r 0.00 comet_storm
s 12.27 ice_nova,if=(!talent.prismatic_crystal.enabled|(charges=1&cooldown.prismatic_crystal.remains>recharge_time&buff.incanters_flow.stack>3))&(buff.icy_veins.up|(charges=1&cooldown.icy_veins.remains>recharge_time))
t 31.24 frostfire_bolt,if=buff.brain_freeze.react
u 0.00 ice_lance,if=set_bonus.tier17_4pc&talent.thermal_void.enabled&talent.mirror_image.enabled&dot.frozen_orb.ticking
v 0.00 ice_lance,if=talent.frost_bomb.enabled&buff.fingers_of_frost.react&debuff.frost_bomb.remains>travel_time&(!talent.thermal_void.enabled|cooldown.icy_veins.remains>8)
w 0.00 frostbolt,if=set_bonus.tier17_2pc&buff.ice_shard.up&!(talent.thermal_void.enabled&buff.icy_veins.up&buff.icy_veins.remains<10)
Camp procs and spam Frostbolt while 4T17 buff is up
x 27.31 ice_lance,if=!talent.frost_bomb.enabled&buff.fingers_of_frost.react&(!talent.thermal_void.enabled|cooldown.icy_veins.remains>8)
y 10.02 water_jet,if=buff.fingers_of_frost.react=0&!dot.frozen_orb.ticking
z 102.27 frostbolt
{ 0.00 ice_lance,moving=1

Sample Sequence

013678Xnpqs9zzzttxyzzqxtzztzzzzzszzzzzxzttyzzxzzzxtsxzzznqtzzqqxyzzxts9qxzzxtzzzxtzzyztsxzzzzzxt9zztDqnqqqsqzztyzzxxzztqxzsx9zzzzztqtxyzzzqtzzXbstxnqqzzq9qqtyzzxsxzztxzzzttxzzyzttsxzzxzzxtDzznqqzszqxyzzxxzz9ztzzzzstxzztqxyzzxzx

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 168000.0/168000: 100% mana
Pre food Fluffy_Pillow 168000.0/168000: 100% mana
Pre water_elemental Fluffy_Pillow 168000.0/168000: 100% mana
Pre mirror_image Fluffy_Pillow 168000.0/168000: 100% mana
Pre potion Fluffy_Pillow 168000.0/168000: 100% mana draenic_intellect_potion
0:00.000 frostbolt Fluffy_Pillow 161600.0/168000: 96% mana mark_of_the_frostwolf, draenic_intellect_potion
0:00.000 icy_veins Fluffy_Pillow 161600.0/168000: 96% mana mark_of_the_frostwolf, draenic_intellect_potion
0:00.000 frozen_orb Fluffy_Pillow 161600.0/168000: 96% mana icy_veins, mark_of_the_frostwolf, draenic_intellect_potion
0:01.351 ice_nova Fluffy_Pillow 151232.9/168000: 90% mana bloodlust, fingers_of_frost, icy_veins, nightmare_fire, mark_of_the_frostwolf, draenic_intellect_potion
0:02.392 ice_lance Fluffy_Pillow 155573.3/168000: 93% mana bloodlust, fingers_of_frost, icy_veins, nightmare_fire, mark_of_the_frostwolf, draenic_intellect_potion
0:03.432 ice_nova Fluffy_Pillow 158309.5/168000: 94% mana bloodlust, icy_veins, nightmare_fire, mark_of_the_frostwolf, draenic_intellect_potion
0:04.471 counterspell Fluffy_Pillow 162641.5/168000: 97% mana bloodlust, icy_veins, nightmare_fire, mark_of_the_frostwolf, draenic_intellect_potion
0:04.471 frostbolt Fluffy_Pillow 159441.5/168000: 95% mana bloodlust, icy_veins, enhanced_frostbolt, nightmare_fire, mark_of_the_frostwolf, draenic_intellect_potion
0:05.510 frostbolt Fluffy_Pillow 157373.6/168000: 94% mana bloodlust, brain_freeze, icy_veins, nightmare_fire, mark_of_the_frostwolf, draenic_intellect_potion
0:06.895 frostbolt Fluffy_Pillow 156748.3/168000: 93% mana bloodlust, brain_freeze(2), icy_veins, nightmare_fire, draenic_intellect_potion
0:08.280 frostfire_bolt Fluffy_Pillow 156122.9/168000: 93% mana bloodlust, brain_freeze(2), icy_veins, nightmare_fire, draenic_intellect_potion
0:09.320 frostfire_bolt Fluffy_Pillow 160459.1/168000: 96% mana bloodlust, brain_freeze, fingers_of_frost, icy_veins, nightmare_fire, draenic_intellect_potion
0:10.360 ice_lance Fluffy_Pillow 164795.3/168000: 98% mana bloodlust, fingers_of_frost, icy_veins, nightmare_fire, draenic_intellect_potion
0:11.402 water_jet Fluffy_Pillow 167539.9/168000: 100% mana bloodlust, icy_veins, nightmare_fire, draenic_intellect_potion
0:11.402 frostbolt Fluffy_Pillow 167539.9/168000: 100% mana bloodlust, icy_veins, nightmare_fire, draenic_intellect_potion
0:12.788 frostbolt Fluffy_Pillow 166918.7/168000: 99% mana bloodlust, fingers_of_frost, icy_veins, nightmare_fire, draenic_intellect_potion
0:14.173 ice_lance Fluffy_Pillow 166293.4/168000: 99% mana bloodlust, brain_freeze, fingers_of_frost(2), icy_veins, nightmare_fire, mark_of_the_frostwolf, draenic_intellect_potion
0:15.213 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, brain_freeze, fingers_of_frost, icy_veins, nightmare_fire, mark_of_the_frostwolf, draenic_intellect_potion
0:16.253 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, brain_freeze, icy_veins, nightmare_fire, mark_of_the_frostwolf, draenic_intellect_potion
0:17.294 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, icy_veins, nightmare_fire, mark_of_the_frostwolf, draenic_intellect_potion
0:18.679 frostbolt Fluffy_Pillow 167374.7/168000: 100% mana bloodlust, brain_freeze, icy_veins, nightmare_fire, mark_of_the_frostwolf, draenic_intellect_potion
0:20.065 frostfire_bolt Fluffy_Pillow 166753.5/168000: 99% mana bloodlust, brain_freeze, icy_veins, mark_of_the_frostwolf
0:21.106 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, icy_veins, enhanced_frostbolt
0:22.147 frostbolt Fluffy_Pillow 165940.4/168000: 99% mana bloodlust, icy_veins
0:23.532 frostbolt Fluffy_Pillow 165315.0/168000: 98% mana bloodlust, icy_veins
0:24.918 frostbolt Fluffy_Pillow 164693.9/168000: 98% mana bloodlust, icy_veins
0:26.304 frostbolt Fluffy_Pillow 164072.7/168000: 98% mana bloodlust, icy_veins
0:27.690 ice_nova Fluffy_Pillow 163451.6/168000: 97% mana bloodlust, icy_veins
0:28.731 frostbolt Fluffy_Pillow 167791.9/168000: 100% mana bloodlust
0:30.116 frostbolt Fluffy_Pillow 167166.6/168000: 100% mana bloodlust
0:31.503 frostbolt Fluffy_Pillow 166549.6/168000: 99% mana bloodlust
0:32.889 frostbolt Fluffy_Pillow 165928.4/168000: 99% mana bloodlust
0:34.274 frostbolt Fluffy_Pillow 165303.1/168000: 98% mana bloodlust, fingers_of_frost
0:35.660 ice_lance Fluffy_Pillow 164682.0/168000: 98% mana bloodlust, brain_freeze, fingers_of_frost, mark_of_the_frostwolf
0:36.700 frostbolt Fluffy_Pillow 167418.2/168000: 100% mana bloodlust, brain_freeze, mark_of_the_frostwolf
0:38.085 frostfire_bolt Fluffy_Pillow 166792.8/168000: 99% mana bloodlust, brain_freeze(2), mark_of_the_frostwolf
0:39.124 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, brain_freeze, mark_of_the_frostwolf
0:40.166 water_jet Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, mark_of_the_frostwolf
0:40.166 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, enhanced_frostbolt, mark_of_the_frostwolf
0:41.206 frostbolt Fluffy_Pillow 164935.5/168000: 98% mana mark_of_the_frostwolf
0:43.006 ice_lance Fluffy_Pillow 164308.6/168000: 98% mana fingers_of_frost
0:44.359 frostbolt Fluffy_Pillow 167048.0/168000: 99% mana
0:46.159 frostbolt Fluffy_Pillow 166421.1/168000: 99% mana
0:47.959 frostbolt Fluffy_Pillow 165794.2/168000: 99% mana fingers_of_frost
0:49.757 ice_lance Fluffy_Pillow 165160.8/168000: 98% mana brain_freeze, fingers_of_frost(2)
0:51.108 frostfire_bolt Fluffy_Pillow 167893.8/168000: 100% mana brain_freeze, fingers_of_frost
0:52.459 ice_nova Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost
0:53.809 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost, mark_of_the_frostwolf
0:55.159 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana mark_of_the_frostwolf
0:56.958 frostbolt Fluffy_Pillow 167369.9/168000: 100% mana enhanced_frostbolt, mark_of_the_frostwolf
0:58.308 frostbolt Fluffy_Pillow 165299.7/168000: 98% mana brain_freeze, mark_of_the_frostwolf
1:00.106 frozen_orb Fluffy_Pillow 164666.3/168000: 98% mana brain_freeze
1:01.455 ice_lance Fluffy_Pillow 152992.9/168000: 91% mana brain_freeze, fingers_of_frost
1:02.806 frostfire_bolt Fluffy_Pillow 155725.9/168000: 93% mana brain_freeze
1:04.156 frostbolt Fluffy_Pillow 160055.7/168000: 95% mana
1:05.955 frostbolt Fluffy_Pillow 159425.6/168000: 95% mana
1:07.753 ice_lance Fluffy_Pillow 158792.2/168000: 95% mana fingers_of_frost(2), mark_of_the_frostwolf
1:09.105 ice_lance Fluffy_Pillow 161528.4/168000: 96% mana fingers_of_frost(2), mark_of_the_frostwolf
1:10.455 ice_lance Fluffy_Pillow 164258.2/168000: 98% mana fingers_of_frost, mark_of_the_frostwolf(2)
1:11.806 water_jet Fluffy_Pillow 166991.2/168000: 99% mana mark_of_the_frostwolf(2)
1:11.806 frostbolt Fluffy_Pillow 166991.2/168000: 99% mana mark_of_the_frostwolf(2)
1:13.606 frostbolt Fluffy_Pillow 166364.3/168000: 99% mana enhanced_frostbolt, mark_of_the_frostwolf(2)
1:14.957 ice_lance Fluffy_Pillow 164297.3/168000: 98% mana brain_freeze, fingers_of_frost, mark_of_the_frostwolf(2)
1:16.307 frostfire_bolt Fluffy_Pillow 167027.1/168000: 99% mana brain_freeze, fingers_of_frost
1:17.657 ice_nova Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost(2)
1:19.006 counterspell Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost(2)
1:19.006 ice_lance Fluffy_Pillow 164800.0/168000: 98% mana fingers_of_frost(2)
1:20.356 ice_lance Fluffy_Pillow 167529.8/168000: 100% mana fingers_of_frost
1:21.707 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
1:23.507 frostbolt Fluffy_Pillow 167373.1/168000: 100% mana fingers_of_frost
1:25.306 ice_lance Fluffy_Pillow 166742.9/168000: 99% mana brain_freeze, fingers_of_frost, mark_of_the_frostwolf
1:26.656 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana brain_freeze, mark_of_the_frostwolf
1:28.008 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana mark_of_the_frostwolf
1:29.808 frostbolt Fluffy_Pillow 167373.1/168000: 100% mana mark_of_the_frostwolf
1:31.607 frostbolt Fluffy_Pillow 166742.9/168000: 99% mana fingers_of_frost, enhanced_frostbolt, mark_of_the_frostwolf
1:32.958 ice_lance Fluffy_Pillow 164675.9/168000: 98% mana brain_freeze, fingers_of_frost, mark_of_the_frostwolf
1:34.309 frostfire_bolt Fluffy_Pillow 167408.9/168000: 100% mana brain_freeze, mark_of_the_frostwolf
1:35.659 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana mark_of_the_frostwolf
1:37.459 frostbolt Fluffy_Pillow 167373.1/168000: 100% mana mark_of_the_frostwolf
1:39.257 water_jet Fluffy_Pillow 166739.7/168000: 99% mana brain_freeze
1:39.257 frostbolt Fluffy_Pillow 166739.7/168000: 99% mana brain_freeze
1:41.055 frostfire_bolt Fluffy_Pillow 166106.4/168000: 99% mana brain_freeze
1:42.404 ice_nova Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost
1:43.754 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost
1:45.107 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
1:46.907 frostbolt Fluffy_Pillow 167373.1/168000: 100% mana
1:48.705 frostbolt Fluffy_Pillow 166739.7/168000: 99% mana enhanced_frostbolt
1:50.055 frostbolt Fluffy_Pillow 164669.5/168000: 98% mana
1:51.853 frostbolt Fluffy_Pillow 164036.2/168000: 98% mana fingers_of_frost
1:53.653 ice_lance Fluffy_Pillow 163409.2/168000: 97% mana brain_freeze, fingers_of_frost
1:55.003 frostfire_bolt Fluffy_Pillow 166139.0/168000: 99% mana brain_freeze
1:56.354 counterspell Fluffy_Pillow 168000.0/168000: 100% mana
1:56.354 frostbolt Fluffy_Pillow 164800.0/168000: 98% mana mark_of_the_frostwolf
1:58.153 frostbolt Fluffy_Pillow 164169.9/168000: 98% mana brain_freeze, mark_of_the_frostwolf
1:59.953 frostfire_bolt Fluffy_Pillow 163542.9/168000: 97% mana brain_freeze, fingers_of_frost, nightmare_fire, mark_of_the_frostwolf
2:01.305 mirror_image Fluffy_Pillow 167879.1/168000: 100% mana fingers_of_frost(2), nightmare_fire, mark_of_the_frostwolf
2:02.655 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost(2), nightmare_fire
2:04.005 frozen_orb Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost, nightmare_fire
2:05.356 ice_lance Fluffy_Pillow 156333.0/168000: 93% mana fingers_of_frost(2), nightmare_fire
2:06.707 ice_lance Fluffy_Pillow 159066.0/168000: 95% mana fingers_of_frost, nightmare_fire
2:08.059 ice_lance Fluffy_Pillow 161802.2/168000: 96% mana fingers_of_frost, nightmare_fire
2:09.408 ice_nova Fluffy_Pillow 164528.8/168000: 98% mana fingers_of_frost, nightmare_fire
2:10.757 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost, nightmare_fire
2:12.108 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana enhanced_frostbolt, nightmare_fire
2:13.458 frostbolt Fluffy_Pillow 165929.8/168000: 99% mana brain_freeze, nightmare_fire, mark_of_the_frostwolf
2:15.258 frostfire_bolt Fluffy_Pillow 165302.9/168000: 98% mana brain_freeze, nightmare_fire, mark_of_the_frostwolf
2:16.609 water_jet Fluffy_Pillow 168000.0/168000: 100% mana nightmare_fire, mark_of_the_frostwolf
2:16.609 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana nightmare_fire, mark_of_the_frostwolf
2:18.409 frostbolt Fluffy_Pillow 167373.1/168000: 100% mana nightmare_fire, mark_of_the_frostwolf
2:20.209 ice_lance Fluffy_Pillow 166746.1/168000: 99% mana fingers_of_frost
2:21.560 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost
2:22.911 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
2:24.711 frostbolt Fluffy_Pillow 167373.1/168000: 100% mana brain_freeze, fingers_of_frost
2:26.510 frostfire_bolt Fluffy_Pillow 166742.9/168000: 99% mana brain_freeze, fingers_of_frost
2:27.861 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost(2)
2:29.213 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost
2:30.562 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana enhanced_frostbolt
2:31.913 ice_nova Fluffy_Pillow 165933.0/168000: 99% mana fingers_of_frost
2:33.263 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost
2:34.614 counterspell Fluffy_Pillow 168000.0/168000: 100% mana
2:34.614 frostbolt Fluffy_Pillow 164800.0/168000: 98% mana
2:36.413 frostbolt Fluffy_Pillow 164169.9/168000: 98% mana
2:38.213 frostbolt Fluffy_Pillow 163542.9/168000: 97% mana
2:40.014 frostbolt Fluffy_Pillow 162919.2/168000: 97% mana
2:41.814 frostbolt Fluffy_Pillow 162292.3/168000: 97% mana brain_freeze
2:43.613 frostfire_bolt Fluffy_Pillow 161662.1/168000: 96% mana brain_freeze(2), fingers_of_frost, mark_of_the_frostwolf
2:44.964 ice_lance Fluffy_Pillow 165995.1/168000: 99% mana brain_freeze, fingers_of_frost(2), mark_of_the_frostwolf
2:46.315 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana brain_freeze, fingers_of_frost, mark_of_the_frostwolf
2:47.665 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost, mark_of_the_frostwolf
2:49.016 water_jet Fluffy_Pillow 168000.0/168000: 100% mana mark_of_the_frostwolf(2)
2:49.016 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana enhanced_frostbolt, mark_of_the_frostwolf(2)
2:50.366 frostbolt Fluffy_Pillow 165929.8/168000: 99% mana mark_of_the_frostwolf(2)
2:52.165 frostbolt Fluffy_Pillow 165299.7/168000: 98% mana brain_freeze, fingers_of_frost, mark_of_the_frostwolf(2)
2:53.966 ice_lance Fluffy_Pillow 164675.9/168000: 98% mana brain_freeze, fingers_of_frost(2)
2:55.317 frostfire_bolt Fluffy_Pillow 167408.9/168000: 100% mana brain_freeze, fingers_of_frost
2:56.666 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost
2:58.466 frostbolt Fluffy_Pillow 167373.1/168000: 100% mana fingers_of_frost
3:00.266 icy_veins Fluffy_Pillow 166746.1/168000: 99% mana brain_freeze, fingers_of_frost
3:00.266 potion Fluffy_Pillow 166746.1/168000: 99% mana brain_freeze, fingers_of_frost, icy_veins
3:00.266 ice_nova Fluffy_Pillow 166746.1/168000: 99% mana brain_freeze, fingers_of_frost, icy_veins, draenic_intellect_potion
3:01.615 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana brain_freeze, fingers_of_frost, icy_veins, draenic_intellect_potion
3:02.966 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost, icy_veins, draenic_intellect_potion
3:04.318 frozen_orb Fluffy_Pillow 168000.0/168000: 100% mana icy_veins, draenic_intellect_potion
3:05.669 ice_lance Fluffy_Pillow 156333.0/168000: 93% mana fingers_of_frost(2), icy_veins, mark_of_the_frostwolf, draenic_intellect_potion
3:07.019 ice_lance Fluffy_Pillow 159062.8/168000: 95% mana fingers_of_frost, icy_veins, mark_of_the_frostwolf, draenic_intellect_potion
3:08.369 frostbolt Fluffy_Pillow 161792.6/168000: 96% mana icy_veins, enhanced_frostbolt, mark_of_the_frostwolf, draenic_intellect_potion
3:09.720 frostbolt Fluffy_Pillow 159725.6/168000: 95% mana icy_veins, mark_of_the_frostwolf, draenic_intellect_potion
3:11.519 ice_lance Fluffy_Pillow 159095.5/168000: 95% mana brain_freeze, fingers_of_frost(2), icy_veins, draenic_intellect_potion
3:12.867 counterspell Fluffy_Pillow 161818.8/168000: 96% mana brain_freeze, fingers_of_frost(2), icy_veins, draenic_intellect_potion
3:12.867 ice_lance Fluffy_Pillow 158618.8/168000: 94% mana brain_freeze, fingers_of_frost(2), icy_veins, draenic_intellect_potion
3:14.218 ice_lance Fluffy_Pillow 161351.8/168000: 96% mana brain_freeze, fingers_of_frost, icy_veins, draenic_intellect_potion
3:15.568 frostfire_bolt Fluffy_Pillow 164081.6/168000: 98% mana brain_freeze, icy_veins, draenic_intellect_potion
3:16.918 water_jet Fluffy_Pillow 168000.0/168000: 100% mana icy_veins, draenic_intellect_potion
3:16.918 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana icy_veins, draenic_intellect_potion
3:18.716 frostbolt Fluffy_Pillow 167366.6/168000: 100% mana icy_veins, draenic_intellect_potion
3:20.515 ice_lance Fluffy_Pillow 166736.5/168000: 99% mana fingers_of_frost, icy_veins, draenic_intellect_potion
3:21.865 ice_nova Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost, icy_veins, draenic_intellect_potion
3:23.215 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost, icy_veins, mark_of_the_frostwolf, draenic_intellect_potion
3:24.566 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana icy_veins, mark_of_the_frostwolf, draenic_intellect_potion
3:26.365 frostbolt Fluffy_Pillow 167369.9/168000: 100% mana brain_freeze, icy_veins, enhanced_frostbolt, mark_of_the_frostwolf
3:27.716 frostfire_bolt Fluffy_Pillow 165302.9/168000: 98% mana brain_freeze, fingers_of_frost, icy_veins, mark_of_the_frostwolf
3:29.068 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost, icy_veins
3:30.419 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana icy_veins
3:32.219 frostbolt Fluffy_Pillow 167373.1/168000: 100% mana icy_veins
3:34.019 frostbolt Fluffy_Pillow 166746.1/168000: 99% mana brain_freeze, icy_veins, mark_of_the_frostwolf
3:35.819 frostfire_bolt Fluffy_Pillow 166119.2/168000: 99% mana brain_freeze(2), fingers_of_frost, icy_veins, mark_of_the_frostwolf
3:37.169 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana brain_freeze, fingers_of_frost, icy_veins, mark_of_the_frostwolf
3:38.522 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost, mark_of_the_frostwolf
3:39.871 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana mark_of_the_frostwolf
3:41.671 frostbolt Fluffy_Pillow 167373.1/168000: 100% mana mark_of_the_frostwolf
3:43.469 water_jet Fluffy_Pillow 166739.7/168000: 99% mana brain_freeze, mark_of_the_frostwolf
3:43.469 frostbolt Fluffy_Pillow 166739.7/168000: 99% mana brain_freeze, enhanced_frostbolt, mark_of_the_frostwolf
3:44.821 frostfire_bolt Fluffy_Pillow 164675.9/168000: 98% mana brain_freeze(2), mark_of_the_frostwolf
3:46.171 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana brain_freeze, fingers_of_frost, mark_of_the_frostwolf
3:47.521 ice_nova Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost, mark_of_the_frostwolf
3:48.870 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost
3:50.219 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
3:52.018 frostbolt Fluffy_Pillow 167369.9/168000: 100% mana fingers_of_frost
3:53.819 ice_lance Fluffy_Pillow 166746.1/168000: 99% mana fingers_of_frost
3:55.171 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
3:56.970 frostbolt Fluffy_Pillow 167369.9/168000: 100% mana fingers_of_frost
3:58.769 ice_lance Fluffy_Pillow 166739.7/168000: 99% mana brain_freeze, fingers_of_frost
4:00.119 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana brain_freeze
4:01.470 mirror_image Fluffy_Pillow 168000.0/168000: 100% mana
4:02.821 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana enhanced_frostbolt
4:04.172 frostbolt Fluffy_Pillow 165933.0/168000: 99% mana fingers_of_frost
4:05.973 frozen_orb Fluffy_Pillow 165309.3/168000: 98% mana fingers_of_frost
4:07.324 ice_lance Fluffy_Pillow 153642.3/168000: 91% mana fingers_of_frost(2)
4:08.674 ice_lance Fluffy_Pillow 156372.1/168000: 93% mana fingers_of_frost
4:10.024 frostbolt Fluffy_Pillow 159101.9/168000: 95% mana
4:11.825 ice_nova Fluffy_Pillow 158478.1/168000: 94% mana fingers_of_frost
4:13.176 frostbolt Fluffy_Pillow 162811.2/168000: 97% mana fingers_of_frost
4:14.975 ice_lance Fluffy_Pillow 162181.0/168000: 97% mana fingers_of_frost(2)
4:16.325 ice_lance Fluffy_Pillow 164910.8/168000: 98% mana fingers_of_frost
4:17.677 water_jet Fluffy_Pillow 167647.0/168000: 100% mana
4:17.677 frostbolt Fluffy_Pillow 167647.0/168000: 100% mana
4:19.476 frostbolt Fluffy_Pillow 167016.9/168000: 99% mana enhanced_frostbolt
4:20.828 ice_lance Fluffy_Pillow 164953.1/168000: 98% mana fingers_of_frost, mark_of_the_frostwolf
4:22.179 ice_lance Fluffy_Pillow 167686.1/168000: 100% mana fingers_of_frost, mark_of_the_frostwolf
4:23.531 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana mark_of_the_frostwolf
4:25.333 frostbolt Fluffy_Pillow 167379.5/168000: 100% mana mark_of_the_frostwolf
4:27.133 counterspell Fluffy_Pillow 166752.5/168000: 99% mana brain_freeze, nightmare_fire
4:27.133 frostbolt Fluffy_Pillow 163552.5/168000: 97% mana brain_freeze, nightmare_fire
4:28.931 frostfire_bolt Fluffy_Pillow 162919.2/168000: 97% mana brain_freeze, nightmare_fire
4:30.282 frostbolt Fluffy_Pillow 167252.2/168000: 100% mana nightmare_fire
4:32.080 frostbolt Fluffy_Pillow 166618.8/168000: 99% mana nightmare_fire
4:33.880 frostbolt Fluffy_Pillow 165991.9/168000: 99% mana nightmare_fire
4:35.680 frostbolt Fluffy_Pillow 165365.0/168000: 98% mana fingers_of_frost, nightmare_fire
4:37.481 ice_nova Fluffy_Pillow 164741.2/168000: 98% mana brain_freeze, fingers_of_frost, nightmare_fire
4:38.830 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana brain_freeze, fingers_of_frost, nightmare_fire
4:40.178 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost, nightmare_fire
4:41.528 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana enhanced_frostbolt, nightmare_fire
4:42.879 frostbolt Fluffy_Pillow 165933.0/168000: 99% mana brain_freeze, nightmare_fire
4:44.680 frostfire_bolt Fluffy_Pillow 165309.3/168000: 98% mana brain_freeze, fingers_of_frost, nightmare_fire
4:46.030 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost(2), nightmare_fire
4:47.381 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost
4:48.730 water_jet Fluffy_Pillow 168000.0/168000: 100% mana
4:48.730 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
4:50.530 frostbolt Fluffy_Pillow 167373.1/168000: 100% mana
4:52.328 ice_lance Fluffy_Pillow 166739.7/168000: 99% mana fingers_of_frost
4:53.678 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost
4:55.478 ice_lance Fluffy_Pillow 167373.1/168000: 100% mana fingers_of_frost(2)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 674 642 642
Agility 935 891 891
Stamina 4150 3773 3773
Intellect 3915 3466 3354 (2257)
Spirit 1155 1155 1155
Health 249000 226380 0
Mana 168000 168000 0
Spell Power 5515 4565 1099
Crit 13.30% 8.30% 363
Haste 11.36% 6.06% 501
Multistrike 29.80% 15.21% 1004
Damage / Heal Versatility 4.76% 1.76% 229
ManaReg per Second 3207 3055 0
Mastery 42.24% 32.24% 893
Armor 614 614 614

Talents

Level
15 Evanesce Blazing Speed Ice Floes
30 Alter Time Flameglow Ice Barrier
45 Ring of Frost Ice Ward Frostjaw
60 Greater Invisibility Cauterize Cold Snap
75 Frost Bomb (Frost Mage) Unstable Magic Ice Nova (Frost Mage)
90 Mirror Image Rune of Power Incanter's Flow
100 Thermal Void (Frost Mage) Prismatic Crystal Comet Storm (Frost Mage)

Profile

mage="Zentimeter"
origin="http://eu.battle.net/wow/en/character/forscherliga/Zentimeter/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/110/70512494-avatar.jpg"
level=100
race=gnome
role=spell
position=back
professions=tailoring=685/enchanting=690
talents=http://eu.battle.net/wow/en/tool/talent-calculator#eb!2201200
glyphs=icy_veins/splitting_ice/water_elemental/conjure_familiar/evaporation/momentum
spec=frost

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_intellect_flask
actions.precombat+=/food,type=calamari_crepes
actions.precombat+=/arcane_brilliance
actions.precombat+=/water_elemental
actions.precombat+=/snapshot_stats
actions.precombat+=/rune_of_power
actions.precombat+=/mirror_image
actions.precombat+=/potion,name=draenic_intellect
actions.precombat+=/frostbolt

# Executed every time the actor is available.

actions=counterspell,if=target.debuff.casting.react
actions+=/blink,if=movement.distance>10
actions+=/blazing_speed,if=movement.remains>0
actions+=/time_warp,if=target.health.pct<25|time>5
actions+=/mirror_image
actions+=/ice_floes,if=buff.ice_floes.down&(raid_event.movement.distance>0|raid_event.movement.in<action.frostbolt.cast_time)
actions+=/rune_of_power,if=buff.rune_of_power.remains<cast_time
actions+=/rune_of_power,if=(cooldown.icy_veins.remains<gcd.max&buff.rune_of_power.remains<20)|(cooldown.prismatic_crystal.remains<gcd.max&buff.rune_of_power.remains<10)
actions+=/call_action_list,name=cooldowns,if=time_to_die<24
actions+=/call_action_list,name=crystal_sequence,if=talent.prismatic_crystal.enabled&(cooldown.prismatic_crystal.remains<=gcd.max|pet.prismatic_crystal.active)
actions+=/call_action_list,name=aoe,if=active_enemies>=4
actions+=/call_action_list,name=single_target

# Actions while Prismatic Crystal is active
actions.crystal_sequence=frost_bomb,if=active_enemies=1&current_target!=prismatic_crystal&remains<10
actions.crystal_sequence+=/frozen_orb
actions.crystal_sequence+=/call_action_list,name=cooldowns
actions.crystal_sequence+=/prismatic_crystal
actions.crystal_sequence+=/frost_bomb,if=talent.prismatic_crystal.enabled&current_target=prismatic_crystal&active_enemies>1&!ticking
actions.crystal_sequence+=/ice_lance,if=buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&active_dot.frozen_orb>=1)
actions.crystal_sequence+=/ice_nova,if=charges=2
actions.crystal_sequence+=/frostfire_bolt,if=buff.brain_freeze.react
actions.crystal_sequence+=/ice_lance,if=buff.fingers_of_frost.react
actions.crystal_sequence+=/ice_nova
actions.crystal_sequence+=/blizzard,interrupt_if=cooldown.frozen_orb.up|(talent.frost_bomb.enabled&buff.fingers_of_frost.react=2),if=active_enemies>=5
actions.crystal_sequence+=/frostbolt

# Consolidated damage cooldown abilities
actions.cooldowns=icy_veins
actions.cooldowns+=/blood_fury
actions.cooldowns+=/berserking
actions.cooldowns+=/arcane_torrent
actions.cooldowns+=/potion,name=draenic_intellect,if=buff.bloodlust.up|buff.icy_veins.up

# AoE sequence
actions.aoe=call_action_list,name=cooldowns
actions.aoe+=/frost_bomb,if=remains<action.ice_lance.travel_time&(cooldown.frozen_orb.remains<gcd.max|buff.fingers_of_frost.react=2)
actions.aoe+=/frozen_orb
actions.aoe+=/ice_lance,if=talent.frost_bomb.enabled&buff.fingers_of_frost.react&debuff.frost_bomb.up
actions.aoe+=/comet_storm
actions.aoe+=/ice_nova
actions.aoe+=/blizzard,interrupt_if=cooldown.frozen_orb.up|(talent.frost_bomb.enabled&buff.fingers_of_frost.react=2)

# Single target sequence
actions.single_target=call_action_list,name=cooldowns,if=!talent.prismatic_crystal.enabled|cooldown.prismatic_crystal.remains>15
# Safeguards against losing FoF and BF to buff expiry
actions.single_target+=/ice_lance,if=buff.fingers_of_frost.react&buff.fingers_of_frost.remains<action.frostbolt.execute_time
actions.single_target+=/frostfire_bolt,if=buff.brain_freeze.react&buff.brain_freeze.remains<action.frostbolt.execute_time
# Frozen Orb usage without Prismatic Crystal
actions.single_target+=/frost_bomb,if=!talent.prismatic_crystal.enabled&cooldown.frozen_orb.remains<gcd.max&debuff.frost_bomb.remains<10
actions.single_target+=/frozen_orb,if=!talent.prismatic_crystal.enabled&buff.fingers_of_frost.stack<2&cooldown.icy_veins.remains>45
# Single target routine; Rough summary: IN2 > FoF2 > CmS > IN > BF > FoF
actions.single_target+=/frost_bomb,if=remains<action.ice_lance.travel_time&(buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&(talent.thermal_void.enabled|buff.fingers_of_frost.remains<gcd.max*2)))
actions.single_target+=/ice_nova,if=time_to_die<10|(charges=2&(!talent.prismatic_crystal.enabled|!cooldown.prismatic_crystal.up))
actions.single_target+=/ice_lance,if=buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&dot.frozen_orb.ticking)
actions.single_target+=/comet_storm
actions.single_target+=/ice_nova,if=(!talent.prismatic_crystal.enabled|(charges=1&cooldown.prismatic_crystal.remains>recharge_time&buff.incanters_flow.stack>3))&(buff.icy_veins.up|(charges=1&cooldown.icy_veins.remains>recharge_time))
actions.single_target+=/frostfire_bolt,if=buff.brain_freeze.react
actions.single_target+=/ice_lance,if=set_bonus.tier17_4pc&talent.thermal_void.enabled&talent.mirror_image.enabled&dot.frozen_orb.ticking
actions.single_target+=/ice_lance,if=talent.frost_bomb.enabled&buff.fingers_of_frost.react&debuff.frost_bomb.remains>travel_time&(!talent.thermal_void.enabled|cooldown.icy_veins.remains>8)
# Camp procs and spam Frostbolt while 4T17 buff is up
actions.single_target+=/frostbolt,if=set_bonus.tier17_2pc&buff.ice_shard.up&!(talent.thermal_void.enabled&buff.icy_veins.up&buff.icy_veins.remains<10)
actions.single_target+=/ice_lance,if=!talent.frost_bomb.enabled&buff.fingers_of_frost.react&(!talent.thermal_void.enabled|cooldown.icy_veins.remains>8)
actions.single_target+=/water_jet,if=buff.fingers_of_frost.react=0&!dot.frozen_orb.ticking
actions.single_target+=/frostbolt
actions.single_target+=/ice_lance,moving=1

head=vilebreath_mask,id=113596
neck=cratermaker_choker,id=116285,enchant=75mult
shoulders=slaughterhouse_spaulders,id=113609,bonus_id=566
back=kyusys_tarflame_doomcloak,id=119346,enchant=gift_of_multistrike
chest=hexweave_robe,id=114813,bonus_id=195/525/538
tabard=stormwind_tabard,id=118365
wrists=crystalwoven_bracers,id=113642
hands=sterilized_handwraps,id=115998,bonus_id=563,gems=35mult
waist=hexweave_belt,id=114816,bonus_id=184/525/538
legs=trousers_of_arcane_mystery,id=109804,bonus_id=524
feet=felflame_sandals,id=109797,bonus_id=524
finger1=diamondglow_circle,id=109763,bonus_id=524,enchant=30mult
finger2=timeless_solium_band_of_the_archmage,id=118296,enchant=50mult
trinket1=sandmans_pouch,id=112320,bonus_id=525/530
trinket2=tovras_lightning_repository,id=110001,bonus_id=524
main_hand=grandiose_spire,id=115333,bonus_id=66,enchant=mark_of_the_frostwolf

# Gear Summary
# gear_stamina=2883
# gear_intellect=2257
# gear_spell_power=1099
# gear_crit_rating=363
# gear_haste_rating=501
# gear_mastery_rating=893
# gear_armor=614
# gear_multistrike_rating=956
# gear_versatility_rating=229

Zambo

Zambo : 16599 dps, 32435 dtps, 18856 hps (8449 aps), 126.3k TMI, 122.6k ETMI

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR   HPS HPS(e) HPS Error HPS Range HPR   APS APS Error APS Range APR
16599.3 16599.3 6.0 / 0.036% 1909.2 / 11.5% 15.7       10406.1 10406.1 4.67 / 0.04% 1480 / 14.2% 9.9       8449.4 13.20 / 0.16% 2090 / 24.7% 9.9
DTPS DTPS Error DTPS Range   TMI TMI Error TMI Min TMI Max TMI Range   MSD Mean MSD Min MSD Max MSD Freq.   Window Bin Size
32435.0 22.90 / 0.07% 7230 / 22.3%       126.3k 78 / 0.06% 103.0k 162.6k 25.0k / 19.8%       102.2% 73.0% 153.3% 3.4       6.00s 0.50s
RPS Out RPS In Primary Resource Waiting APM Active Skill
1053.0 1053.0 Mana 0.79% 65.2 100.0% 100%
Origin http://eu.battle.net/wow/en/character/dalvengyr/Zambo/advanced
Talents
  • 15: Pursuit of Justice
  • 30: Fist of Justice
  • 45: Sacred Shield (Protection Paladin)
  • 60: Unbreakable Spirit
  • 75: Divine Purpose
  • 90: Light's Hammer
  • 100: Holy Shield
  • Talent Calculator
Glyphs
  • Glyph of the Alabaster Shield
  • Glyph of Final Wrath
  • Glyph of the Consecrator
  • Glyph of Pillar of Light
  • Glyph of Contemplation
Professions
  • mining: 700
  • blacksmithing: 700

Charts

http://6.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Zambo+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x270&chd=t:47037|13831|12052|12036|11049|8376|4008|2174&chds=0,94074&chco=FFE57F,FFE57F,FFE57F,FFE57F,FFE57F,FFE57F,C79C6E,C79C6E&chm=t++47037++lights_hammer,FFE57F,0,0,15|t++13831++holy_wrath,FFE57F,1,0,15|t++12052++consecration,FFE57F,2,0,15|t++12036++hammer_of_wrath,FFE57F,3,0,15|t++11049++avengers_shield,FFE57F,4,0,15|t++8376++judgment,FFE57F,5,0,15|t++4008++crusader_strike,C79C6E,6,0,15|t++2174++melee,C79C6E,7,0,15& http://7.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Zambo+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:25,13,11,10,8,8,7,6,6,2,2,0&chds=0,100&chdls=ffffff&chco=FFE57F,C79C6E,FFE57F,FFE57F,FFE57F,C79C6E,FFE57F,FFE57F,FFE57F,C79C6E,FFE57F,C79C6E&chl=shield_of_the_righteous|melee|judgment|avengers_shield|holy_shield|crusader_strike|consecration|lights_hammer_damage_tick|holy_wrath|shattered_bleed|hammer_of_wrath|ardent_defender& DPS Taken Timeline Chart
http://9.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Zambo+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:dgjlqtwy357667865410xwvvssrronmomlmllklllkkkkjiijijijiijkjjjlmmmmonpprqqsutsrsrsrrqqqrqpnmnmkkljkjkihhihgfffggffeefgfffgghghghiijijkmmlklllklkkkmlkiiihgggfffgfffggfeffgggggghihhghgggfeffgfgfhhihhhhjjkkklnmmlmklklkkkkkjihihhggfgghggfhggfgggghhgghihhhjjjijjjkllklmnmmmmllllkkkljjjjjjiiiiijkjjjlkkjkjjjkiiijiihhihhghgggihhhkjkklllllmmmmnnnnnmlkkjjiiiihijhhghfffffeeedaZYWUSQPNM&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.62134,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=16599|max=26715&chxp=1,1,62,100 Resolve Timeline Chart http://2.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Zambo+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,0,2,3,6,15,30,42,87,125,225,311,441,626,787,1013,1187,1306,1559,1639,1679,1661,1695,1584,1482,1357,1139,1012,841,727,562,482,361,254,225,142,115,83,62,53,18,21,15,12,6,4,1,1,0,1&chds=0,1695&chbh=5&chxt=x&chxl=0:|min=14780|avg=16599|max=18891&chxp=0,1,44,100& http://8.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Zambo+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:33.4,22.4,15.5,10.1,6.8,6.4,2.5,2.1,0.8&chds=0,100&chdls=ffffff&chco=C79C6E,FFE57F,FFE57F,FFE57F,FFE57F,FFE57F,FFE57F,FFE57F,ffffff&chl=crusader_strike 100.6s|judgment 67.4s|avengers_shield 46.7s|consecration 30.5s|holy_wrath 20.6s|sacred_shield 19.4s|hammer_of_wrath 7.6s|lights_hammer 6.4s|waiting 2.4s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% B% M-Count M-Hit M-Crit M-Crit% Up%
Zambo 16599
ardent_defender 0 0.0% 2.0 0.00sec 14 0 Direct 2.0 14 0 14 0.0% 0.0% 0.0 0 0 0.0%  

Stats details: ardent_defender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 27.75 42.65 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 13.91 14 14 13.91 14 14 28 43 34.93
 
DPS Timeline Chart
 

Action details: ardent_defender

Static Values
  • id:31850
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:time<5|(buff.holy_avenger.down&buff.shield_of_the_righteous.down&buff.divine_protection.down&buff.guardian_of_ancient_kings.down)
Spelldata
  • id:31850
  • name:Ardent Defender
  • school:physical
  • tooltip:Damage taken reduced by $?a171427[${$m1+10}%][$m1%]. The next attack that would otherwise kill you will instead cause you to be healed for $w2% of your maximum health.
  • description:{$?s159548=false}[][Reduce damage taken by {$s1=20}% for {$d=10 seconds}. ]While Ardent Defender is active, the next attack that would otherwise kill you will instead cause you to be healed for {$s2=12}% of your maximum health.{$?s159548=false}[ If this effect expires without triggering, its cooldown will be reset to {$159548s1=60} sec.][]
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:20.00
  • base_dd_max:20.00
 
avengers_shield 1720 10.4% 37.1 8.13sec 13936 11049 Direct 37.1 11486 23074 13139 14.3% 0.0% 7.5 3447 6927 14.4%  

Stats details: avengers_shield

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.06 37.05 0.00 0.00 1.2613 0.0000 516525.32 516525.32 0.00 11048.91 11048.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.08 14.38% 6927.46 6522 8734 4563.26 0 8734 7485 7485 0.00
multistrike 6.43 85.62% 3446.53 3261 4367 3443.70 0 4367 22166 22166 0.00
hit 31.77 85.73% 11485.88 10870 14556 11496.02 10870 12313 364868 364868 0.00
crit 5.29 14.27% 23073.87 21741 29112 22978.24 0 29112 122006 122006 0.00
 
DPS Timeline Chart
 

Action details: avengers_shield

Static Values
  • id:31935
  • school:holy
  • resource:mana
  • range:30.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:2240.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.grand_crusader.react&active_enemies>1&!glyph.focused_shield.enabled
Spelldata
  • id:31935
  • name:Avenger's Shield
  • school:holy
  • tooltip:Silenced.
  • description:Hurls your shield at an enemy target, dealing {$s1=1 to 3} Holy damage, {$?s56414=false}[dazing, ][]interrupting and silencing the target for {$d=3 seconds}{$?s54930=false}[][, and then jumping to ${$x1-1} additional nearby enemies].
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.680000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:3.00
 
consecration 1222 7.4% 24.3 11.42sec 15109 12052 Periodic 214.8 1411 2832 1611 14.1% 0.0% 43.5 423 850 14.0% 71.4%

Stats details: consecration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.30 24.30 214.85 214.85 1.2537 1.0000 367141.33 367141.33 0.00 1496.64 12051.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 6.1 14.02% 849.72 2 1082 847.95 0 1082 5182 5182 0.00
multistrike 37.4 85.98% 423.36 0 541 423.67 392 472 15836 15836 0.00
hit 184.6 85.93% 1411.09 1 1803 1412.16 1364 1462 260519 260519 0.00
crit 30.2 14.07% 2832.32 3 3605 2834.66 2536 3286 85604 85604 0.00
 
DPS Timeline Chart
 

Action details: consecration

Static Values
  • id:26573
  • school:holy
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:2240.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.debuff.flying.down&active_enemies>=3
Spelldata
  • id:26573
  • name:Consecration
  • school:holy
  • tooltip:Damage every $t1 $lsecond:seconds;.
  • description:Consecrates the land beneath you, causing ${$81297m1*9} Holy damage over {$d=9 seconds} to enemies who enter the area.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:9.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: consecration_tick

Static Values
  • id:81297
  • school:holy
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:81297
  • name:Consecration
  • school:holy
  • tooltip:
  • description:Deals {$s1=1} Holy damage to enemies within $A1 yards.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.138600
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
crusader_strike 1342 8.1% 79.6 3.80sec 5066 4008 Direct 79.6 4181 8397 4776 14.1% 7.5% 16.2 1254 2517 14.0%  

Stats details: crusader_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.57 79.57 0.00 0.00 1.2642 0.0000 403157.54 633855.46 36.40 4007.53 4007.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.09 13.99% 2576.30 2447 3152 2249.34 0 3152 5389 8282 30.49
multistrike_crit (blocked) 0.17 0.22% 1801.22 1713 2206 284.72 0 2206 311 683 8.61
multistrike 12.86 86.01% 1283.24 1224 1576 1284.13 1224 1488 16498 25354 34.93
multistrike (blocked) 1.05 1.32% 897.27 857 1103 580.59 0 1103 941 2066 35.23
hit 63.22 79.45% 4277.06 4079 5253 4280.21 4147 4436 270413 415581 34.93
hit (blocked) 5.12 6.44% 2994.51 2855 3677 2978.23 0 3677 15347 33694 54.12
crit 10.38 13.05% 8589.78 8158 10507 8596.04 0 10507 89199 137085 34.93
crit (blocked) 0.84 1.06% 6019.76 5710 7355 3428.11 0 7355 5061 11111 31.01
 
DPS Timeline Chart
 

Action details: crusader_strike

Static Values
  • id:35395
  • school:physical
  • resource:mana
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:640.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:35395
  • name:Crusader Strike
  • school:physical
  • tooltip:
  • description:{$?s85673=true}|s85256[An instant strike that causes $sw2 Physical damage and grants 1 Holy Power.][An instant strike that causes $sw2 Physical damage.]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.20
 
hammer_of_wrath 305 1.8% 5.8 10.16sec 15808 12036 Direct 5.8 13121 26244 14915 13.7% 0.0% 1.2 3936 7874 13.9%  

Stats details: hammer_of_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.82 5.81 0.00 0.00 1.3135 0.0000 91954.40 91954.40 0.00 12035.92 12035.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.16 13.91% 7873.57 7872 10542 1189.19 0 10542 1289 1289 0.00
multistrike 1.01 86.09% 3936.24 3936 5271 2527.55 0 5271 3989 3989 0.00
hit 5.02 86.33% 13121.05 13120 17570 13118.52 0 16087 65825 65825 0.00
crit 0.79 13.67% 26243.58 26241 35139 14813.37 0 35139 20851 20851 0.00
 
DPS Timeline Chart
 

Action details: hammer_of_wrath

Static Values
  • id:24275
  • school:holy
  • resource:mana
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:960.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:24275
  • name:Hammer of Wrath
  • school:holy
  • tooltip:
  • description:Hurls a magical hammer that strikes an enemy for {$s1=1} Holy damage{$?s53503=false}[ and generates a charge of Holy Power][]. Only usable on enemies that have 20% or less health{$?s53503=false}[ or during Avenging Wrath][].
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.028000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
holy_shield 1404 8.5% 82.8 3.62sec 5101 0 Direct 82.7 5103 0 5103 0.0% 0.0% 0.0 0 0 0.0%  

Stats details: holy_shield

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.76 82.74 0.00 0.00 0.0000 0.0000 422175.37 422175.37 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.74 100.00% 5102.55 4853 6498 5106.98 4892 5416 422175 422175 0.00
 
DPS Timeline Chart
 

Action details: holy_shield

Static Values
  • id:157122
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:157122
  • name:Holy Shield
  • school:holy
  • tooltip:
  • description:{$@spelldesc152261=Increases your block chance by {$s1=15}%, and allows you to block spells. Additionally, when you block, you deal {$157122s1=1} Holy damage to your attacker.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.750000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
holy_wrath 948 5.7% 16.3 18.41sec 17488 13831 Direct 16.3 14464 29004 16489 13.9% 0.0% 3.3 4339 8690 14.1%  

Stats details: holy_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.29 16.29 0.00 0.00 1.2645 0.0000 284920.10 284920.10 0.00 13831.07 13831.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.47 14.12% 8690.07 7453 11180 3256.50 0 11180 4048 4048 0.00
multistrike 2.83 85.88% 4339.06 3727 7485 4095.48 0 7485 12296 12296 0.00
hit 14.02 86.08% 14464.39 12422 24951 14473.06 12422 16573 202799 202799 0.00
crit 2.27 13.92% 29004.12 24844 49902 26312.89 0 37373 65777 65777 0.00
 
DPS Timeline Chart
 

Action details: holy_wrath

Static Values
  • id:119072
  • school:holy
  • resource:mana
  • range:0.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1600.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.sanctified_wrath.enabled
Spelldata
  • id:119072
  • name:Holy Wrath
  • school:holy
  • tooltip:Stunned.
  • description:Sends bolts of power in all directions, causing {$s2=1} Holy damage {$?s115738=false}[to your target][divided among all enemies within $A1 yards], stunning Demons{$?s54923=false}[, Aberrations, Dragonkin, Elementals][] and Undead for {$d=3 seconds}.{$?s171648=false}[ Generates {$171648s2=1} Holy Power.][]{$?s54935=true}[ Causes {$54935s1=50}% additional damage to targets with less than 20% health.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.920000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
judgment 1879 11.3% 53.4 5.66sec 10575 8376 Direct 53.4 8720 17550 9969 14.1% 0.0% 10.8 2616 5265 14.2%  

Stats details: judgment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.37 53.37 0.00 0.00 1.2626 0.0000 564418.00 564418.00 0.00 8375.65 8375.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.53 14.16% 5265.22 4938 6612 4109.90 0 6612 8060 8060 0.00
multistrike 9.28 85.84% 2616.21 2469 3306 2617.88 0 3306 24277 24277 0.00
hit 45.83 85.86% 8720.24 8230 11020 8727.83 8391 9130 399607 399607 0.00
crit 7.55 14.14% 17550.25 16460 22041 17561.38 0 22041 132474 132474 0.00
 
DPS Timeline Chart
 

Action details: judgment

Static Values
  • id:20271
  • school:holy
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:glyph.double_jeopardy.enabled&last_judgment_target!=target
Spelldata
  • id:20271
  • name:Judgment
  • school:holy
  • tooltip:
  • description:Causes {$s1=1} Holy damage {$?s105424=false}[and generates 1 Holy Power]?s85256[and generates 1 Holy Power][]. Requires an active Seal to cast.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.696000
  • spell_power_mod.direct:0.576000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
lights_hammer 0 (4059) 0.0% (22.3%) 5.1 64.05sec 59005 47037

Stats details: lights_hammer

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.12 5.10 39.97 39.97 1.2545 1.7448 0.00 0.00 0.00 3967.67 47037.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.10 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: lights_hammer

Static Values
  • id:114158
  • school:holy
  • resource:mana
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:16608.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.seraphim.enabled|buff.seraphim.remains>10|cooldown.seraphim.remains<6
Spelldata
  • id:114158
  • name:Light's Hammer
  • school:physical
  • tooltip:
  • description:Hurls a Light-infused hammer into the ground, where it blasts a 10 yard radius every $114918t1 sec for ${{$122773d=15.500 seconds}-1.5} sec. Each blast deals {$114919s1=1 to 3} Holy damage to enemies, reduces enemy movement speed by {$114919s2=50}% for {$114919d=2 seconds}, and heals up to 6 allies for {$119952s1=0}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    lights_hammer_damage_tick 1006 6.1% 40.0 7.05sec 7561 0 Direct 40.0 6216 12551 7128 14.4% 0.0% 8.1 1865 3761 14.3%  

Stats details: lights_hammer_damage_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.97 39.97 0.00 0.00 0.0000 0.0000 302165.85 302165.85 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.16 14.34% 3761.28 3339 4471 2565.54 0 4471 4367 4367 0.00
multistrike 6.94 85.66% 1864.68 1670 2236 1866.92 0 2236 12935 12935 0.00
hit 34.21 85.61% 6216.49 5566 7452 6229.53 5687 6852 212696 212696 0.00
crit 5.75 14.39% 12550.56 11131 14905 12535.97 0 14905 72168 72168 0.00
 
DPS Timeline Chart
 

Action details: lights_hammer_damage_tick

Static Values
  • id:114919
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114919
  • name:Arcing Light
  • school:holy
  • tooltip:Movement slowed by {$s2=50}%.
  • description:{$@spelldesc114158=Hurls a Light-infused hammer into the ground, where it blasts a 10 yard radius every $114918t1 sec for ${{$122773d=15.500 seconds}-1.5} sec. Each blast deals {$114919s1=1 to 3} Holy damage to enemies, reduces enemy movement speed by {$114919s2=50}% for {$114919d=2 seconds}, and heals up to 6 allies for {$119952s1=0}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.860000
  • base_dd_min:1.00
  • base_dd_max:3.00
 
melee 2171 13.1% 144.6 2.07sec 4511 2174 Direct 144.6 3719 7467 4253 14.2% 7.5% 29.3 1115 2240 14.2%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 144.63 144.63 0.00 0.00 2.0753 0.0000 652473.24 1025799.23 36.39 2173.89 2173.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.86 14.22% 2291.39 2184 2820 2236.72 0 2820 8836 13579 34.07
multistrike_crit (blocked) 0.31 0.22% 1604.33 1529 1974 431.38 0 1974 501 1100 14.64
multistrike 23.26 85.78% 1141.14 1092 1410 1141.95 1092 1286 26542 40790 34.93
multistrike (blocked) 1.89 1.31% 799.18 764 987 673.14 0 987 1509 3313 45.85
hit 114.74 79.33% 3804.62 3640 4700 3807.32 3711 3916 436526 670872 34.93
hit (blocked) 9.29 6.43% 2662.21 2548 3290 2663.27 0 3290 24742 54321 54.44
crit 19.06 13.18% 7638.47 7279 9400 7644.85 7279 8764 145572 223722 34.93
crit (blocked) 1.54 1.07% 5348.24 5095 6580 4184.82 0 6580 8245 18102 42.57
 
DPS Timeline Chart
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
shattered_bleed 388 2.3% 17.6 17.38sec 6619 0 Direct 17.6 1603 3207 1836 14.5% 0.0% 3.6 481 962 14.7%  
Periodic 97.8 792 0 792 0.0% 0.0% 19.8 240 0 0.0% 32.5%

Stats details: shattered_bleed

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.61 17.61 97.83 97.83 0.0000 1.0000 116538.71 116538.71 0.00 1191.24 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.53 14.71% 961.96 962 962 389.79 0 962 505 505 0.00
multistrike 3.05 85.29% 480.98 481 481 455.22 0 481 1465 1465 0.00
hit 15.05 85.47% 1603.27 1603 1603 1603.27 1603 1603 24126 24126 0.00
crit 2.56 14.53% 3206.54 3207 3207 2956.43 0 3207 8202 8202 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike 19.8 100.00% 240.49 240 240 240.49 240 240 4767 4767 0.00
hit 97.8 100.00% 791.91 1 802 792.17 763 802 77473 77473 0.00
 
DPS Timeline Chart
 

Action details: shattered_bleed

Static Values
  • id:159238
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:159238
  • name:Shattered Bleed
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2.
  • description:Inflicts {$s1=1500} Bleed damage, plus an additional $o2 damage over {$d=6 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1499.91
  • base_dd_max:1499.91
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:749.87
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
shield_of_the_righteous 4215 25.4% 71.2 4.15sec 17793 0 Direct 71.2 14675 29417 16773 14.2% 7.5% 14.4 4402 8829 14.3%  

Stats details: shield_of_the_righteous

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 71.19 71.19 0.00 0.00 0.0000 0.0000 1266750.24 1266750.24 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.91 14.32% 8828.36 7826 13623 7481.80 0 13623 16845 16845 0.00
multistrike_crit (blocked) 0.15 0.22% 8830.32 7826 13623 1261.96 0 13623 1354 1354 0.00
multistrike 11.42 85.68% 4401.28 3913 6812 4406.40 3913 5764 50263 50263 0.00
multistrike (blocked) 0.93 1.31% 4405.40 3913 6812 2663.76 0 6812 4116 4116 0.00
hit 56.50 79.36% 14674.44 13043 22705 14690.58 13833 15990 829158 829158 0.00
hit (blocked) 4.56 6.40% 14681.52 13043 22705 14532.00 0 22705 66911 66911 0.00
crit 9.37 13.16% 29416.05 26086 45411 29451.10 0 41918 275667 275667 0.00
crit (blocked) 0.76 1.07% 29430.28 26086 45411 15690.28 0 45411 22436 22436 0.00
 
DPS Timeline Chart
 

Action details: shield_of_the_righteous

Static Values
  • id:53600
  • school:holy
  • resource:holy_power
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:3.0
  • cooldown:1.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.divine_purpose.react
Spelldata
  • id:53600
  • name:Shield of the Righteous
  • school:holy
  • tooltip:
  • description:Instantly slam the target with your shield, causing {$s1=1} Holy damage, reducing the physical damage you take by ${$clamp($132403m1*-1,20,80)}% for {$132403d=3 seconds}, and causing Bastion of Glory. |cFFFFFFFFBastion of Glory|r {$@spelldesc114637=Increases the strength of {$?s114163=false}[your Eternal Flame][your Word of Glory] when used to heal yourself by {$114637s1=6}%. Stacks up to 5 times.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.016000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Healing and Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Zambo 10406
holy_shield_absorb 1580 8.4% 0.0 0.00sec 0 0 Direct 31.7 15022 0 15022 0.0% 0.0 0 0 0.0%  

Stats details: holy_shield_absorb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 0.00 31.67 0.00 0.00 0.0000 0.0000 475773.66 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.67 100.00% 15022.46 0 41402 15016.41 10852 20025 475774 0 0.00
 
HPS Timeline Chart
 
lights_hammer_heal_tick 3054 16.2% 0.0 0.00sec 0 0 Direct 239.8 3092 6083 3612 17.4% 48.6 912 1809 17.4%  

Stats details: lights_hammer_heal_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 0.00 239.79 0.00 0.00 0.0000 0.0000 918076.05 2636719.89 65.18 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 8.45 17.38% 1808.57 0 15322 1818.74 0 15114 15286 45109 70.03
multistrike 40.17 82.62% 911.82 0 7672 913.16 0 2666 36627 106184 66.28
hit 198.11 82.62% 3092.39 0 25573 3097.10 2043 4069 612625 1745800 64.96
crit 41.68 17.38% 6082.69 0 51128 6099.25 0 19127 253537 739626 66.35
 
HPS Timeline Chart
 

Action details: lights_hammer_heal_tick

Static Values
  • id:114919
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zambo
  • harmful:false
  • if_expr:
Spelldata
  • id:114919
  • name:Arcing Light
  • school:holy
  • tooltip:Movement slowed by {$s2=50}%.
  • description:{$@spelldesc114158=Hurls a Light-infused hammer into the ground, where it blasts a 10 yard radius every $114918t1 sec for ${{$122773d=15.500 seconds}-1.5} sec. Each blast deals {$114919s1=1 to 3} Holy damage to enemies, reduces enemy movement speed by {$114919s2=50}% for {$114919d=2 seconds}, and heals up to 6 allies for {$119952s1=0}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.860000
  • base_dd_min:1.00
  • base_dd_max:3.00
 
sacred_shield_tick 6862 36.4% 0.0 0.00sec 0 0 Direct 70.9 29105 0 29105 0.0% 0.0 0 0 0.0%  

Stats details: sacred_shield_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 0.00 70.89 0.00 0.00 0.0000 0.0000 2063361.63 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 70.89 100.00% 29104.94 0 156550 29102.69 24231 35634 2063362 0 0.00
 
HPS Timeline Chart
 

Action details: sacred_shield_tick

Static Values
  • id:65148
  • school:holy
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zambo
  • harmful:true
  • if_expr:
Spelldata
  • id:65148
  • name:Sacred Shield
  • school:holy
  • tooltip:Absorbs up to $w1 damage.
  • description:{$@spelldesc20925=Protects the target with a shield of Holy Light for {$d=30 seconds}, absorbing up to {$?s85256=false}[${$m1+1.306*$SPH/0.7}][${$m1+1.306*$SPH}] damage every $t1 sec. Only one target can be affected at a time.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.305995
  • base_dd_min:0.00
  • base_dd_max:0.00
 
seal_of_insight_proc 7040 37.3% 261.0 1.22sec 8109 0 Direct 261.0 6528 12971 7645 17.3% 52.9 1952 3882 17.4%  

Stats details: seal_of_insight_proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 261.01 261.01 0.00 0.00 0.0000 0.0000 2116586.40 2152976.94 1.69 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 9.20 17.38% 3882.00 0 5708 3882.79 0 5582 35706 36607 2.50
multistrike 43.73 82.62% 1951.73 0 2853 1952.36 1528 2193 85355 86899 1.81
hit 215.73 82.65% 6527.52 0 9510 6529.90 5980 6836 1408177 1429097 1.49
crit 45.28 17.35% 12970.97 0 19026 12974.16 10311 14782 587349 600374 2.20
 
HPS Timeline Chart
 

Action details: seal_of_insight_proc

Static Values
  • id:20165
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zambo
  • harmful:false
  • if_expr:
Spelldata
  • id:20165
  • name:Seal of Insight
  • school:holy
  • tooltip:Improves healing by {$s2=5}%. Melee attacks have a chance to heal.
  • description:Fills you with Holy Light, increasing healing done by {$s2=5}% and giving melee attacks a chance to heal {$?s119477=false}[the most wounded member of your party or raid for ${$20167m1*0.45}][you for {$20167s1=0}].
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.160000
  • spell_power_mod.direct:0.160000
  • base_dd_min:0.00
  • base_dd_max:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
shining_protector 312 1.7% 39.2 7.72sec 2397 0 Direct 39.2 2397 0 2397 0.0% 0.0 0 0 0.0%  

Stats details: shining_protector

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 39.18 39.18 0.00 0.00 0.0000 0.0000 93921.89 96643.88 2.82 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.18 100.00% 2397.43 0 15314 2398.10 1365 4045 93922 96644 2.79
 
HPS Timeline Chart
 

Action details: shining_protector

Static Values
  • id:159374
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zambo
  • harmful:false
  • if_expr:
Spelldata
  • id:159374
  • name:Shining Protector
  • school:holy
  • tooltip:
  • description:All heals you receive, including multistrikes, have a chance equal to your multistrike chance to trigger Shining Protector, healing you for an additional {$s1=30}% of the triggering heal.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6607.20
  • base_dd_max:6607.20
 
Simple Action Stats Execute Interval
Zambo
divine_protection 10.5 30.02sec

Stats details: divine_protection

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.53 10.53 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.53 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: divine_protection

Static Values
  • id:498
  • school:holy
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:1120.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:time<5|!talent.seraphim.enabled|(buff.seraphim.down&cooldown.seraphim.remains>5&cooldown.seraphim.remains<9)
Spelldata
  • id:498
  • name:Divine Protection
  • school:holy
  • tooltip:Magical damage taken reduced by $w1%.$?$w2!=0[ Physical damage taken reduced by $w2%.][]
  • description:Reduces magical damage taken by {$s1=40}% {$?s54924=false}[and physical damage taken by {$s2=0}%][] for {$d=8 seconds}.
 
draenic_armor_potion 2.0 0.00sec

Stats details: draenic_armor_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156430
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156430
  • name:Draenic Armor Potion
  • school:physical
  • tooltip:Armor increased by {$s1=1500}.
  • description:Increases your bonus armor by {$s1=1500} for {$d=25 seconds}.
 
guardian_of_ancient_kings 2.0 181.02sec

Stats details: guardian_of_ancient_kings

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: guardian_of_ancient_kings

Static Values
  • id:86659
  • school:holy
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:time<5|(buff.holy_avenger.down&buff.shield_of_the_righteous.down&buff.divine_protection.down)
Spelldata
  • id:86659
  • name:Guardian of Ancient Kings
  • school:holy
  • tooltip:Protected by a Guardian of Ancient Kings. Incoming damage reduced by {$86657s2=50}%.
  • description:Summons a Guardian of Ancient Kings to protect you for {$d=8 seconds}. The Guardian of Ancient Kings reduces damage taken by {$86657s2=50}%.
 
sacred_shield 16.4 18.78sec

Stats details: sacred_shield

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 16.37 16.37 60.14 0.00 1.1822 4.9699 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.37 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
HPS Timeline Chart
 

Action details: sacred_shield

Static Values
  • id:20925
  • school:holy
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zambo
  • harmful:false
  • if_expr:
Spelldata
  • id:20925
  • name:Sacred Shield
  • school:holy
  • tooltip:Absorbs up to $w1 damage every $t1 sec.
  • description:Protects the target with a shield of Holy Light for {$d=30 seconds}, absorbing up to {$?s85256=false}[${$m1+1.306*$SPH/0.7}][${$m1+1.306*$SPH}] damage every $t1 sec. Only one target can be affected at a time.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:30.00
  • base_tick_time:6.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 

Action details: sacred_shield_tick

Static Values
  • id:65148
  • school:holy
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zambo
  • harmful:true
  • if_expr:
Spelldata
  • id:65148
  • name:Sacred Shield
  • school:holy
  • tooltip:Absorbs up to $w1 damage.
  • description:{$@spelldesc20925=Protects the target with a shield of Holy Light for {$d=30 seconds}, absorbing up to {$?s85256=false}[${$m1+1.306*$SPH/0.7}][${$m1+1.306*$SPH}] damage every $t1 sec. Only one target can be affected at a time.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.305995
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    sacred_shield_tick 6862 36.4% 0.0 0.00sec 0 0 Direct 70.9 29105 0 29105 0.0% 0.0% 0.0 0 0 0.0%  

Stats details: sacred_shield_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 0.00 70.89 0.00 0.00 0.0000 0.0000 2063361.63 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 70.89 100.00% 29104.94 0 156550 29102.69 24231 35634 2063362 0 0.00
 
HPS Timeline Chart
 

Action details: sacred_shield_tick

Static Values
  • id:65148
  • school:holy
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zambo
  • harmful:true
  • if_expr:
Spelldata
  • id:65148
  • name:Sacred Shield
  • school:holy
  • tooltip:Absorbs up to $w1 damage.
  • description:{$@spelldesc20925=Protects the target with a shield of Holy Light for {$d=30 seconds}, absorbing up to {$?s85256=false}[${$m1+1.306*$SPH/0.7}][${$m1+1.306*$SPH}] damage every $t1 sec. Only one target can be affected at a time.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.305995
  • base_dd_min:0.00
  • base_dd_max:0.00
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
alabaster_shield 36.1 15.0 8.1sec 5.7sec 36.04% 50.39% 0.4(0.4)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_alabaster_shield
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • alabaster_shield_1:27.81%
  • alabaster_shield_2:6.95%
  • alabaster_shield_3:1.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:121467
  • name:Alabaster Shield
  • tooltip:Increases Shield of the Righteous damage by {$s1=10}%.
  • description:{$@spelldesc63222=Your successful blocks increase the damage of your next Shield of the Righteous by {$121467s1=10}%. Stacks up to {$121467u=3}1 times.}
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
ardent_defender 2.0 0.0 201.8sec 180.7sec 3.92% 3.94% 0.0(0.0)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_ardent_defender
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • ardent_defender_1:3.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31850
  • name:Ardent Defender
  • tooltip:Damage taken reduced by $?a171427[${$m1+10}%][$m1%]. The next attack that would otherwise kill you will instead cause you to be healed for $w2% of your maximum health.
  • description:{$?s159548=false}[][Reduce damage taken by {$s1=20}% for {$d=10 seconds}. ]While Ardent Defender is active, the next attack that would otherwise kill you will instead cause you to be healed for {$s2=12}% of your maximum health.{$?s159548=false}[ If this effect expires without triggering, its cooldown will be reset to {$159548s1=60} sec.][]
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bastion_of_glory 1.0 70.2 0.0sec 4.2sec 97.79% 97.79% 66.2(66.2)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_bastion_of_glory
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bastion_of_glory_1:1.11%
  • bastion_of_glory_2:1.13%
  • bastion_of_glory_3:1.14%
  • bastion_of_glory_4:1.14%
  • bastion_of_glory_5:93.26%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114637
  • name:Bastion of Glory
  • tooltip:{$?s114163=false}[Your next Eternal Flame][Your next Word of Glory] used to heal yourself heals for an additional $w1%.
  • description:Increases the strength of {$?s114163=false}[your Eternal Flame][your Word of Glory] when used to heal yourself by {$114637s1=6}%. Stacks up to 5 times.
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 33.34% 0.0(0.0)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_protection 10.5 0.0 30.0sec 30.0sec 27.63% 30.01% 0.0(0.0)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_divine_protection
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • divine_protection_1:27.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:498
  • name:Divine Protection
  • tooltip:Magical damage taken reduced by $w1%.$?$w2!=0[ Physical damage taken reduced by $w2%.][]
  • description:Reduces magical damage taken by {$s1=40}% {$?s54924=false}[and physical damage taken by {$s2=0}%][] for {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
divine_purpose 17.8 0.0 15.6sec 15.6sec 7.53% 100.00% 0.0(0.0)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_divine_purpose
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:25.00%
  • default_value:0.00

Stack Uptimes

  • divine_purpose_1:7.53%

Trigger Attempt Success

  • trigger_pct:24.64%

Spelldata details

  • id:86172
  • name:Divine Purpose
  • tooltip:
  • description:{$?s114163=false}[Eternal Flame][Word of Glory]{$?s53600=true}[ and Shield of the Righteous have]?s53563[ and Light of Dawn have]?s85256[, Templar's Verdict, and Divine Storm have][ has] a {$s1=25}% chance to cause your next {$?s114163=false}[Eternal Flame][Word of Glory] or {$?s53600=true}[Shield of the Righteous]?s53563[Light of Dawn]?s157048[Final Verdict or Divine Storm][Templar's Verdict or Divine Storm] to consume no Holy Power but cast as if 3 were consumed.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:25.00%
draenic_armor_potion 2.0 0.0 67.1sec 0.0sec 15.21% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_draenic_armor_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:bonus_armor
  • amount:1500.00

Stack Uptimes

  • draenic_armor_potion_1:15.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156430
  • name:Draenic Armor Potion
  • tooltip:Armor increased by {$s1=1500}.
  • description:Increases your bonus armor by {$s1=1500} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
grand_crusader 30.1 2.4 9.8sec 9.0sec 17.19% 80.35% 2.4(2.4)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_grand_crusader
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:30.00%
  • default_value:0.00

Stack Uptimes

  • grand_crusader_1:17.19%

Trigger Attempt Success

  • trigger_pct:30.02%

Spelldata details

  • id:85416
  • name:Grand Crusader
  • tooltip:Your next Avenger's Shield will generate 1 Holy Power.
  • description:{$@spelldesc85043=When you avoid a melee attack you have a {$h=30}% chance of refreshing the cooldown on your next Avenger's Shield and causing it to generate 1 Holy Power.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
guardian_of_ancient_kings 2.0 0.0 190.0sec 181.5sec 5.41% 4.51% 0.0(0.0)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_guardian_of_ancient_kings
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • guardian_of_ancient_kings_1:5.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:86659
  • name:Guardian of Ancient Kings
  • tooltip:Protected by a Guardian of Ancient Kings. Incoming damage reduced by {$86657s2=50}%.
  • description:Summons a Guardian of Ancient Kings to protect you for {$d=8 seconds}. The Guardian of Ancient Kings reduces damage taken by {$86657s2=50}%.
  • max_stacks:0
  • duration:8.00
  • cooldown:180.00
  • default_chance:0.00%
holy_shield 31.7 0.0 9.2sec 9.2sec 0.00% 0.00% 0.0(0.0)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_holy_shield
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:157122
  • name:Holy Shield
  • tooltip:
  • description:{$@spelldesc152261=Increases your block chance by {$s1=15}%, and allows you to block spells. Additionally, when you block, you deal {$157122s1=1} Holy damage to your attacker.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
sacred_shield 3.6 12.8 107.7sec 18.8sec 95.51% 95.51% 12.8(12.8)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_sacred_shield
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • sacred_shield_1:95.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:20925
  • name:Sacred Shield
  • tooltip:Absorbs up to $w1 damage every $t1 sec.
  • description:Protects the target with a shield of Holy Light for {$d=30 seconds}, absorbing up to {$?s85256=false}[${$m1+1.306*$SPH/0.7}][${$m1+1.306*$SPH}] damage every $t1 sec. Only one target can be affected at a time.
  • max_stacks:0
  • duration:30.00
  • cooldown:6.00
  • default_chance:0.00%
sacred_shield_tick (_tick) 58.4 1.7 5.2sec 5.0sec 26.38% 100.00% 1.7(1.7)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_sacred_shield_tick
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • sacred_shield_tick_1:26.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:65148
  • name:Sacred Shield
  • tooltip:Absorbs up to $w1 damage.
  • description:{$@spelldesc20925=Protects the target with a shield of Holy Light for {$d=30 seconds}, absorbing up to {$?s85256=false}[${$m1+1.306*$SPH/0.7}][${$m1+1.306*$SPH}] damage every $t1 sec. Only one target can be affected at a time.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
shield_of_the_righteous 36.3 0.0 8.1sec 8.1sec 70.34% 70.35% 0.0(0.0)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_shield_of_the_righteous
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shield_of_the_righteous_1:70.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:132403
  • name:Shield of the Righteous
  • tooltip:Physical damage taken reduced by $w1%.
  • description:{$@spelldesc53600=Instantly slam the target with your shield, causing {$s1=1} Holy damage, reducing the physical damage you take by ${$clamp($132403m1*-1,20,80)}% for {$132403d=3 seconds}, and causing Bastion of Glory. |cFFFFFFFFBastion of Glory|r {$@spelldesc114637=Increases the strength of {$?s114163=false}[your Eternal Flame][your Word of Glory] when used to heal yourself by {$114637s1=6}%. Stacks up to 5 times.}}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
tectus_heartbeat 5.7 0.0 50.9sec 50.3sec 18.65% 18.66% 0.0(0.0)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_tectus_heartbeat
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:crit_rating
  • amount:2004.00

Stack Uptimes

  • tectus_heartbeat_1:18.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:177040
  • name:Tectus' Heartbeat
  • tooltip:Increases Critical Strike by {$s1=1135}.
  • description:Increases Critical Strike by {$s1=1135} for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_stamina_flask

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_greater_draenic_stamina_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:stamina
  • amount:375.00

Stack Uptimes

  • greater_draenic_stamina_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156084
  • name:Greater Draenic Stamina Flask
  • tooltip:Stamina increased by $w1.
  • description:Increases Stamina by {$s1=375} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
resolve

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_resolve
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • resolve_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%
seal_of_insight

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_seal_of_insight
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • seal_of_insight_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:20165
  • name:Seal of Insight
  • tooltip:Improves healing by {$s2=5}%. Melee attacks have a chance to heal.
  • description:Fills you with Holy Light, increasing healing done by {$s2=5}% and giving melee attacks a chance to heal {$?s119477=false}[the most wounded member of your party or raid for ${$20167m1*0.45}][you for {$20167s1=0}].
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Zambo
avengers_shield Mana 37.1 83024.9 2240.0 2240.0 6.2
consecration Mana 24.3 54430.8 2240.0 2240.0 6.7
crusader_strike Mana 79.6 50927.3 640.0 640.0 7.9
divine_protection Mana 10.5 11793.8 1120.0 1120.0 0.0
hammer_of_wrath Mana 5.8 5584.2 960.0 960.0 16.5
holy_wrath Mana 16.3 26067.5 1600.0 1600.0 10.9
lights_hammer Mana 5.1 85049.9 16608.0 16607.9 3.6
shield_of_the_righteous Holy Power 71.2 160.5 2.3 2.3 7894.7
Resource Gains Type Count Total Average Overflow
shining_protector Health 39.18 93921.64 (2.54%) 2397.43 2721.77 2.82%
holy_shield_absorb Health 31.67 475777.10 (12.85%) 15022.46 0.00 0.00%
seal_of_insight_proc Health 313.94 2116587.59 (57.18%) 6741.97 36387.05 1.69%
lights_hammer_heal_tick Health 48.08 918086.05 (24.80%) 19093.16 25416.40 2.69%
external_healing Health 8.24 75806.21 (2.05%) 9199.78 1826.72 2.35%
leech Health 1020.61 21207.44 (0.57%) 20.78 559.47 2.57%
guarded_by_the_light Mana 149.65 314484.97 (100.00%) 2101.52 403817.83 56.22%
crusader_strike Holy Power 79.57 79.56 (48.86%) 1.00 0.02 0.02%
grand_crusader Holy Power 29.91 29.90 (18.36%) 1.00 0.01 0.05%
judgment Holy Power 53.37 53.36 (32.77%) 1.00 0.01 0.03%
Resource RPS-Gain RPS-Loss
Health 14430.46 32478.91
Mana 1045.03 1052.98
Holy Power 0.54 0.53
Combat End Resource Mean Min Max
Mana 29584.19 13152.00 32000.00
Holy Power 2.33 0.00 5.00
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart Health Change Timeline Chart Health Change Sliding Timeline Chart Theck meloree distribution Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 16.7%

Procs

Count Interval
shining_protector 39.2 7.7sec
seal_of_insight_proc 261.0 1.2sec
parry_haste 24.3 11.8sec
divine_purpose 17.8 15.6sec

Statistics & Data Analysis

Fight Length
Sample Data Zambo Fight Length
Count 25000
Mean 300.94
Minimum 230.43
Maximum 374.11
Spread ( max - min ) 143.68
Range [ ( max - min ) / 2 * 100% ] 23.87%
DPS
Sample Data Zambo Damage Per Second
Count 25000
Mean 16599.34
Minimum 14779.82
Maximum 18891.44
Spread ( max - min ) 4111.63
Range [ ( max - min ) / 2 * 100% ] 12.38%
Standard Deviation 487.4913
5th Percentile 15842.11
95th Percentile 17435.53
( 95th Percentile - 5th Percentile ) 1593.42
Mean Distribution
Standard Deviation 3.0832
95.00% Confidence Intervall ( 16593.30 - 16605.38 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 33
0.1% Error 3313
0.1 Scale Factor Error with Delta=300 2028
0.05 Scale Factor Error with Delta=300 8114
0.01 Scale Factor Error with Delta=300 202869
Distribution Chart
DPS(e)
Sample Data Zambo Damage Per Second (Effective)
Count 25000
Mean 16599.34
Minimum 14779.82
Maximum 18891.44
Spread ( max - min ) 4111.63
Range [ ( max - min ) / 2 * 100% ] 12.38%
Damage
Sample Data Zambo Damage
Count 25000
Mean 4988247.85
Minimum 3643974.13
Maximum 6493354.37
Spread ( max - min ) 2849380.24
Range [ ( max - min ) / 2 * 100% ] 28.56%
DTPS
Sample Data Zambo Damage Taken Per Second
Count 25000
Mean 32435.01
Minimum 25184.44
Maximum 39350.09
Spread ( max - min ) 14165.65
Range [ ( max - min ) / 2 * 100% ] 21.84%
Standard Deviation 1847.4725
5th Percentile 29350.75
95th Percentile 35419.05
( 95th Percentile - 5th Percentile ) 6068.31
Mean Distribution
Standard Deviation 11.6844
95.00% Confidence Intervall ( 32412.10 - 32457.91 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 124
0.1% Error 12463
0.1 Scale Factor Error with Delta=300 29136
0.05 Scale Factor Error with Delta=300 116546
0.01 Scale Factor Error with Delta=300 2913665
Distribution Chart
HPS
Sample Data Zambo Healing Per Second
Count 25000
Mean 10406.09
Minimum 8931.69
Maximum 12310.71
Spread ( max - min ) 3379.02
Range [ ( max - min ) / 2 * 100% ] 16.24%
Standard Deviation 376.6574
5th Percentile 9803.01
95th Percentile 11043.06
( 95th Percentile - 5th Percentile ) 1240.04
Mean Distribution
Standard Deviation 2.3822
95.00% Confidence Intervall ( 10401.42 - 10410.76 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 50
0.1% Error 5032
0.1 Scale Factor Error with Delta=300 1211
0.05 Scale Factor Error with Delta=300 4844
0.01 Scale Factor Error with Delta=300 121109
Distribution Chart
HPS(e)
Sample Data Zambo Healing Per Second (Effective)
Count 25000
Mean 10406.09
Minimum 8931.69
Maximum 12310.71
Spread ( max - min ) 3379.02
Range [ ( max - min ) / 2 * 100% ] 16.24%
Heal
Sample Data Zambo Heal
Count 25000
Mean 3128584.34
Minimum 2207744.91
Maximum 4081210.63
Spread ( max - min ) 1873465.72
Range [ ( max - min ) / 2 * 100% ] 29.94%
HTPS
Sample Data Zambo Healing Taken Per Second
Count 25000
Mean 10658.35
Minimum 8931.69
Maximum 15460.44
Spread ( max - min ) 6528.75
Range [ ( max - min ) / 2 * 100% ] 30.63%
TMI
Sample Data Zambo Theck-Meloree Index
Count 25000
Mean 126286.24
Minimum 103024.12
Maximum 162563.51
Spread ( max - min ) 59539.39
Range [ ( max - min ) / 2 * 100% ] 23.57%
Standard Deviation 6281.4903
5th Percentile 116512.28
95th Percentile 136944.56
( 95th Percentile - 5th Percentile ) 20432.28
Mean Distribution
Standard Deviation 39.7276
95.00% Confidence Intervall ( 126208.37 - 126364.10 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 95
0.1% Error 9504
0.1 Scale Factor Error with Delta=300 336828
0.05 Scale Factor Error with Delta=300 1347314
0.01 Scale Factor Error with Delta=300 33682867
Distribution Chart
ETMI
Sample Data ZamboTheck-Meloree Index (Effective)
Count 25000
Mean 122634.44
Minimum 100618.52
Maximum 158435.41
Spread ( max - min ) 57816.89
Range [ ( max - min ) / 2 * 100% ] 23.57%
Standard Deviation 6480.8489
5th Percentile 112638.98
95th Percentile 133757.44
( 95th Percentile - 5th Percentile ) 21118.46
Mean Distribution
Standard Deviation 40.9885
95.00% Confidence Intervall ( 122554.10 - 122714.77 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 107
0.1% Error 10728
0.1 Scale Factor Error with Delta=300 358548
0.05 Scale Factor Error with Delta=300 1434192
0.01 Scale Factor Error with Delta=300 35854813
Distribution Chart
MSD
Sample Data Zambo Max Spike Value
Count 6213
Mean 102.19
Minimum 73.02
Maximum 153.26
Spread ( max - min ) 80.25
Range [ ( max - min ) / 2 * 100% ] 39.27%
Standard Deviation 10.1414
5th Percentile 87.03
95th Percentile 119.96
( 95th Percentile - 5th Percentile ) 32.93
Mean Distribution
Standard Deviation 0.1287
95.00% Confidence Intervall ( 101.94 - 102.44 )
Normalized 95.00% Confidence Intervall ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 378
0.1% Error 37834
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 3
0.01 Scale Factor Error with Delta=300 87
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_stamina_flask
1 0.00 food,type=talador_surf_and_turf
2 0.00 blessing_of_kings,if=(!aura.str_agi_int.up)&(aura.mastery.up)
3 0.00 blessing_of_might,if=!aura.mastery.up
4 0.00 seal_of_insight
5 0.00 sacred_shield
6 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
7 0.00 potion,name=draenic_armor
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 /auto_attack
9 0.00 speed_of_light,if=movement.remains>1
A 0.00 blood_fury
B 0.00 berserking
C 0.00 arcane_torrent
D 0.00 run_action_list,name=max_dps,if=role.attack|0
This line will shortcut to a high-DPS (but low-survival) action list. Change 0 to 1 if you want to do this all the time.
E 0.00 run_action_list,name=max_survival,if=0
This line will shortcut to a high-survival (but low-DPS) action list. Change 0 to 1 if you want it to do this all the time.
F 1.00 potion,name=draenic_armor,if=buff.shield_of_the_righteous.down&buff.seraphim.down&buff.divine_protection.down&buff.guardian_of_ancient_kings.down&buff.ardent_defender.down
G 0.00 holy_avenger
Standard survival priority list starts here # This section covers off-GCD spells.
H 0.00 seraphim
I 10.53 divine_protection,if=time<5|!talent.seraphim.enabled|(buff.seraphim.down&cooldown.seraphim.remains>5&cooldown.seraphim.remains<9)
J 2.00 guardian_of_ancient_kings,if=time<5|(buff.holy_avenger.down&buff.shield_of_the_righteous.down&buff.divine_protection.down)
K 2.00 ardent_defender,if=time<5|(buff.holy_avenger.down&buff.shield_of_the_righteous.down&buff.divine_protection.down&buff.guardian_of_ancient_kings.down)
L 0.00 eternal_flame,if=buff.eternal_flame.remains<2&buff.bastion_of_glory.react>2&(holy_power>=3|buff.divine_purpose.react|buff.bastion_of_power.react)
M 0.00 eternal_flame,if=buff.bastion_of_power.react&buff.bastion_of_glory.react>=5
N 0.00 harsh_word,if=glyph.harsh_words.enabled&holy_power>=3
O 17.58 shield_of_the_righteous,if=buff.divine_purpose.react
P 53.61 shield_of_the_righteous,if=(holy_power>=5|incoming_damage_1500ms>=health.max*0.3)&(!talent.seraphim.enabled|cooldown.seraphim.remains>5)
Q 0.00 shield_of_the_righteous,if=buff.holy_avenger.remains>time_to_hpg&(!talent.seraphim.enabled|cooldown.seraphim.remains>time_to_hpg)
R 0.00 seal_of_insight,if=talent.empowered_seals.enabled&!seal.insight&buff.uthers_insight.remains<cooldown.judgment.remains
GCD-bound spells start here
S 0.00 seal_of_righteousness,if=talent.empowered_seals.enabled&!seal.righteousness&buff.uthers_insight.remains>cooldown.judgment.remains&buff.liadrins_righteousness.down
T 0.00 seal_of_truth,if=talent.empowered_seals.enabled&!seal.truth&buff.uthers_insight.remains>cooldown.judgment.remains&buff.liadrins_righteousness.remains>cooldown.judgment.remains&buff.maraads_truth.down
U 0.00 avengers_shield,if=buff.grand_crusader.react&active_enemies>1&!glyph.focused_shield.enabled
V 0.00 hammer_of_the_righteous,if=active_enemies>=3
W 79.57 crusader_strike
X 1.70 wait,sec=cooldown.crusader_strike.remains,if=cooldown.crusader_strike.remains>0&cooldown.crusader_strike.remains<=0.35
Y 0.00 judgment,cycle_targets=1,if=glyph.double_jeopardy.enabled&last_judgment_target!=target
Z 53.37 judgment
a 0.54 wait,sec=cooldown.judgment.remains,if=cooldown.judgment.remains>0&cooldown.judgment.remains<=0.35
b 0.00 avengers_shield,if=active_enemies>1&!glyph.focused_shield.enabled
c 0.00 holy_wrath,if=talent.sanctified_wrath.enabled
d 27.98 avengers_shield,if=buff.grand_crusader.react
e 1.14 sacred_shield,if=target.dot.sacred_shield.remains<2
f 3.90 holy_wrath,if=glyph.final_wrath.enabled&target.health.pct<=20
g 9.08 avengers_shield
h 5.12 lights_hammer,if=!talent.seraphim.enabled|buff.seraphim.remains>10|cooldown.seraphim.remains<6
i 0.00 holy_prism,if=!talent.seraphim.enabled|buff.seraphim.up|cooldown.seraphim.remains>5|time<5
j 0.00 consecration,if=target.debuff.flying.down&active_enemies>=3
k 0.00 execution_sentence,if=!talent.seraphim.enabled|buff.seraphim.up|time<12
l 5.82 hammer_of_wrath
m 1.91 sacred_shield,if=target.dot.sacred_shield.remains<8
n 24.30 consecration,if=target.debuff.flying.down
o 12.40 holy_wrath
p 0.00 seal_of_insight,if=talent.empowered_seals.enabled&!seal.insight&buff.uthers_insight.remains<=buff.liadrins_righteousness.remains&buff.uthers_insight.remains<=buff.maraads_truth.remains
q 0.00 seal_of_righteousness,if=talent.empowered_seals.enabled&!seal.righteousness&buff.liadrins_righteousness.remains<=buff.uthers_insight.remains&buff.liadrins_righteousness.remains<=buff.maraads_truth.remains
r 0.00 seal_of_truth,if=talent.empowered_seals.enabled&!seal.truth&buff.maraads_truth.remains<buff.uthers_insight.remains&buff.maraads_truth.remains<buff.liadrins_righteousness.remains
s 12.31 sacred_shield
t 0.00 flash_of_light,if=talent.selfless_healer.enabled&buff.selfless_healer.stack>=3

Sample Sequence

014578IJKWZghWZnWPoZWsgWPZnWsPZWonWZPdWsZPWdInWPZoWdPZOWnsWPOZOXWngWPZdWPdZPWOnoWIZsWPOhZPOWgnWZdWPoZFWnsWPZdWPOdZIWPnoWZsWPOdZWPnsWPZdWnZPWosWZIPnWgZPWhnWZPoWdZWPnsWZXPWnZIWgoPWZdWnZPWsXWZPdPWnZWPdgWPZOIdOWnPZWohWJZnWPgZWKmnWPZdWPOdZWPInoWPOZsWdZWPdnWZPdWoZPOWOnsWZPdIWPlZWflPWZhWgZPWlfWZlWPnZPWgIlWZeWfPZWlgWZPlWnPZWdPfOW

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/5: 100% holy_power
Pre food Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/5: 100% holy_power
Pre seal_of_insight Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/5: 100% holy_power
Pre sacred_shield Zambo 32000.0/32000: 100% mana | 5.0/5: 100% holy_power sacred_shield
Pre potion Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/5: 100% holy_power draenic_armor_potion, sacred_shield
0:00.000 auto_attack Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power draenic_armor_potion, sacred_shield
0:00.000 divine_protection Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power draenic_armor_potion, sacred_shield, sacred_shield_tick
0:00.000 guardian_of_ancient_kings Fluffy_Pillow 30880.0/32000: 97% mana | 0.0/5: 0% holy_power divine_protection, draenic_armor_potion, sacred_shield, sacred_shield_tick
0:00.000 ardent_defender Fluffy_Pillow 30880.0/32000: 97% mana | 0.0/5: 0% holy_power divine_protection, guardian_of_ancient_kings, draenic_armor_potion, sacred_shield, sacred_shield_tick
0:00.000 crusader_strike Fluffy_Pillow 30880.0/32000: 97% mana | 0.0/5: 0% holy_power divine_protection, guardian_of_ancient_kings, ardent_defender, draenic_armor_potion, sacred_shield, sacred_shield_tick
0:01.314 judgment Fluffy_Pillow 30240.0/32000: 95% mana | 1.0/5: 20% holy_power bloodlust, divine_protection, guardian_of_ancient_kings, ardent_defender, draenic_armor_potion, sacred_shield, sacred_shield_tick
0:02.326 avengers_shield Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bloodlust, divine_protection, guardian_of_ancient_kings, ardent_defender, draenic_armor_potion, sacred_shield, sacred_shield_tick
0:03.338 lights_hammer Fluffy_Pillow 29760.0/32000: 93% mana | 2.0/5: 40% holy_power bloodlust, divine_protection, guardian_of_ancient_kings, ardent_defender, draenic_armor_potion, sacred_shield, sacred_shield_tick
0:04.348 crusader_strike Fluffy_Pillow 17952.0/32000: 56% mana | 2.0/5: 40% holy_power bloodlust, divine_protection, guardian_of_ancient_kings, ardent_defender, draenic_armor_potion, sacred_shield, sacred_shield_tick
0:05.360 judgment Fluffy_Pillow 17312.0/32000: 54% mana | 3.0/5: 60% holy_power bloodlust, divine_protection, guardian_of_ancient_kings, ardent_defender, draenic_armor_potion, sacred_shield, sacred_shield_tick
0:06.373 consecration Fluffy_Pillow 22112.0/32000: 69% mana | 4.0/5: 80% holy_power bloodlust, divine_protection, guardian_of_ancient_kings, ardent_defender, draenic_armor_potion, sacred_shield
0:07.385 crusader_strike Fluffy_Pillow 19872.0/32000: 62% mana | 4.0/5: 80% holy_power bloodlust, divine_protection, guardian_of_ancient_kings, ardent_defender, draenic_armor_potion, sacred_shield
0:07.385 shield_of_the_righteous Fluffy_Pillow 19232.0/32000: 60% mana | 2.0/5: 40% holy_power bloodlust, divine_protection, bastion_of_glory, guardian_of_ancient_kings, shield_of_the_righteous, ardent_defender, draenic_armor_potion, sacred_shield
0:08.396 holy_wrath Fluffy_Pillow 24032.0/32000: 75% mana | 2.0/5: 40% holy_power bloodlust, alabaster_shield, bastion_of_glory, shield_of_the_righteous, ardent_defender, draenic_armor_potion, sacred_shield
0:09.408 judgment Fluffy_Pillow 22432.0/32000: 70% mana | 2.0/5: 40% holy_power bloodlust, alabaster_shield, bastion_of_glory, shield_of_the_righteous, ardent_defender, draenic_armor_potion, sacred_shield
0:10.420 crusader_strike Fluffy_Pillow 27232.0/32000: 85% mana | 3.0/5: 60% holy_power bloodlust, alabaster_shield, bastion_of_glory, draenic_armor_potion, sacred_shield
0:11.433 sacred_shield Zambo 26592.0/32000: 83% mana | 4.0/5: 80% holy_power bloodlust, alabaster_shield, bastion_of_glory, draenic_armor_potion, sacred_shield, sacred_shield_tick
0:12.444 avengers_shield Fluffy_Pillow 31392.0/32000: 98% mana | 4.0/5: 80% holy_power bloodlust, alabaster_shield(2), bastion_of_glory, draenic_armor_potion, sacred_shield
0:13.455 crusader_strike Fluffy_Pillow 29152.0/32000: 91% mana | 4.0/5: 80% holy_power bloodlust, alabaster_shield(2), bastion_of_glory, draenic_armor_potion, sacred_shield
0:13.455 shield_of_the_righteous Fluffy_Pillow 28512.0/32000: 89% mana | 2.0/5: 40% holy_power bloodlust, bastion_of_glory(2), shield_of_the_righteous, draenic_armor_potion, sacred_shield
0:14.468 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bloodlust, bastion_of_glory(2), shield_of_the_righteous, draenic_armor_potion, sacred_shield
0:15.481 consecration Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bloodlust, bastion_of_glory(2), shield_of_the_righteous, draenic_armor_potion, sacred_shield
0:16.491 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bloodlust, bastion_of_glory(2), draenic_armor_potion, sacred_shield
0:17.504 sacred_shield Zambo 31360.0/32000: 98% mana | 4.0/5: 80% holy_power bloodlust, bastion_of_glory(2), draenic_armor_potion, sacred_shield
0:18.004 shield_of_the_righteous Fluffy_Pillow 31360.0/32000: 98% mana | 1.0/5: 20% holy_power bloodlust, bastion_of_glory(3), shield_of_the_righteous, draenic_armor_potion, sacred_shield
0:18.516 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, bastion_of_glory(3), shield_of_the_righteous, draenic_armor_potion, sacred_shield
0:19.529 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bloodlust, bastion_of_glory(3), shield_of_the_righteous, draenic_armor_potion, sacred_shield
0:20.541 holy_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bloodlust, bastion_of_glory(3), shield_of_the_righteous, sacred_shield
0:21.552 consecration Fluffy_Pillow 30400.0/32000: 95% mana | 3.0/5: 60% holy_power bloodlust, bastion_of_glory(3), sacred_shield
0:22.562 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bloodlust, bastion_of_glory(3), grand_crusader, sacred_shield
0:23.573 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 4.0/5: 80% holy_power bloodlust, bastion_of_glory(3), grand_crusader, sacred_shield
0:23.573 shield_of_the_righteous Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power bloodlust, bastion_of_glory(4), grand_crusader, shield_of_the_righteous, sacred_shield
0:24.584 avengers_shield Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bloodlust, alabaster_shield, bastion_of_glory(4), grand_crusader, shield_of_the_righteous, sacred_shield
0:25.595 crusader_strike Fluffy_Pillow 29760.0/32000: 93% mana | 3.0/5: 60% holy_power bloodlust, alabaster_shield, bastion_of_glory(4), shield_of_the_righteous, sacred_shield
0:26.607 sacred_shield Zambo 32000.0/32000: 100% mana | 4.0/5: 80% holy_power bloodlust, alabaster_shield, bastion_of_glory(4), sacred_shield
0:27.620 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power bloodlust, alabaster_shield, bastion_of_glory(4), sacred_shield
0:27.620 shield_of_the_righteous Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bloodlust, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
0:28.631 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bloodlust, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
0:29.641 avengers_shield Fluffy_Pillow 31360.0/32000: 98% mana | 3.0/5: 60% holy_power bloodlust, bastion_of_glory(5), grand_crusader, shield_of_the_righteous, sacred_shield
0:30.041 divine_protection Fluffy_Pillow 28000.0/32000: 88% mana | 4.0/5: 80% holy_power bloodlust, divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
0:30.652 consecration Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power bloodlust, divine_protection, bastion_of_glory(5), sacred_shield
0:31.664 crusader_strike Fluffy_Pillow 29760.0/32000: 93% mana | 4.0/5: 80% holy_power bloodlust, divine_protection, bastion_of_glory(5), sacred_shield
0:31.664 shield_of_the_righteous Fluffy_Pillow 29120.0/32000: 91% mana | 2.0/5: 40% holy_power bloodlust, divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
0:32.677 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bloodlust, alabaster_shield, divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
0:33.690 holy_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bloodlust, alabaster_shield, divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
0:34.701 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bloodlust, alabaster_shield(2), divine_protection, bastion_of_glory(5), sacred_shield
0:35.712 avengers_shield Fluffy_Pillow 31360.0/32000: 98% mana | 4.0/5: 80% holy_power bloodlust, alabaster_shield(2), divine_protection, bastion_of_glory(5), grand_crusader, sacred_shield
0:35.712 shield_of_the_righteous Fluffy_Pillow 29120.0/32000: 91% mana | 2.0/5: 40% holy_power bloodlust, divine_purpose, divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
0:36.722 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bloodlust, alabaster_shield, divine_purpose, divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
0:37.522 shield_of_the_righteous Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bloodlust, divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
0:37.734 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bloodlust, divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
0:38.746 consecration Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power bloodlust, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
0:39.759 sacred_shield Zambo 29760.0/32000: 93% mana | 4.0/5: 80% holy_power bloodlust, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
0:40.770 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power bloodlust, bastion_of_glory(5), shield_of_the_righteous, sacred_shield, sacred_shield_tick
0:40.770 shield_of_the_righteous Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power bloodlust, divine_purpose, bastion_of_glory(5), shield_of_the_righteous, sacred_shield, sacred_shield_tick
0:41.780 shield_of_the_righteous Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power divine_purpose, bastion_of_glory(5), shield_of_the_righteous, sacred_shield, sacred_shield_tick
0:41.780 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power divine_purpose, bastion_of_glory(5), shield_of_the_righteous, sacred_shield, sacred_shield_tick
0:43.093 shield_of_the_righteous Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power divine_purpose, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
0:43.093 Waiting 0.400 sec 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
0:43.493 wait Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
0:43.791 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
0:45.105 consecration Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
0:46.419 avengers_shield Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power alabaster_shield, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
0:47.733 crusader_strike Fluffy_Pillow 29760.0/32000: 93% mana | 4.0/5: 80% holy_power alabaster_shield, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
0:47.733 shield_of_the_righteous Fluffy_Pillow 29120.0/32000: 91% mana | 2.0/5: 40% holy_power bastion_of_glory(5), grand_crusader, shield_of_the_righteous, sacred_shield
0:49.046 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bastion_of_glory(5), grand_crusader, shield_of_the_righteous, sacred_shield
0:50.359 avengers_shield Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power alabaster_shield, bastion_of_glory(5), grand_crusader, shield_of_the_righteous, sacred_shield
0:51.673 crusader_strike Fluffy_Pillow 29760.0/32000: 93% mana | 4.0/5: 80% holy_power alabaster_shield, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
0:51.673 shield_of_the_righteous Fluffy_Pillow 29120.0/32000: 91% mana | 2.0/5: 40% holy_power bastion_of_glory(5), grand_crusader, shield_of_the_righteous, sacred_shield
0:52.986 avengers_shield Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power alabaster_shield, bastion_of_glory(5), grand_crusader, shield_of_the_righteous, sacred_shield
0:54.298 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power alabaster_shield, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
0:54.598 shield_of_the_righteous Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power divine_purpose, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
0:55.612 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power divine_purpose, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
0:55.912 shield_of_the_righteous Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
0:56.927 consecration Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
0:58.244 holy_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
0:59.556 crusader_strike Fluffy_Pillow 30400.0/32000: 95% mana | 2.0/5: 40% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
1:00.056 divine_protection Fluffy_Pillow 28640.0/32000: 90% mana | 3.0/5: 60% holy_power divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield, sacred_shield_tick
1:00.869 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield, sacred_shield_tick
1:02.183 sacred_shield Zambo 32000.0/32000: 100% mana | 4.0/5: 80% holy_power alabaster_shield, divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
1:03.496 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power alabaster_shield, divine_protection, bastion_of_glory(5), sacred_shield
1:03.496 shield_of_the_righteous Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power divine_purpose, divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
1:04.810 shield_of_the_righteous Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power divine_purpose, divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield, sacred_shield_tick
1:04.810 lights_hammer Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield, sacred_shield_tick
1:06.125 judgment Fluffy_Pillow 20192.0/32000: 63% mana | 2.0/5: 40% holy_power divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
1:06.125 shield_of_the_righteous Fluffy_Pillow 20192.0/32000: 63% mana | 0.0/5: 0% holy_power divine_purpose, divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
1:07.439 shield_of_the_righteous Fluffy_Pillow 20192.0/32000: 63% mana | 0.0/5: 0% holy_power divine_purpose, divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
1:07.439 crusader_strike Fluffy_Pillow 20192.0/32000: 63% mana | 0.0/5: 0% holy_power divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
1:08.751 avengers_shield Fluffy_Pillow 24352.0/32000: 76% mana | 1.0/5: 20% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
1:10.066 consecration Fluffy_Pillow 26912.0/32000: 84% mana | 1.0/5: 20% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
1:11.380 crusader_strike Fluffy_Pillow 24672.0/32000: 77% mana | 1.0/5: 20% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
1:12.693 judgment Fluffy_Pillow 28832.0/32000: 90% mana | 2.0/5: 40% holy_power bastion_of_glory(5), grand_crusader, shield_of_the_righteous, sacred_shield
1:14.007 avengers_shield Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power alabaster_shield, bastion_of_glory(5), grand_crusader, shield_of_the_righteous, sacred_shield
1:15.321 crusader_strike Fluffy_Pillow 29760.0/32000: 93% mana | 4.0/5: 80% holy_power alabaster_shield, bastion_of_glory(5), shield_of_the_righteous, sacred_shield, sacred_shield_tick
1:15.321 shield_of_the_righteous Fluffy_Pillow 29120.0/32000: 91% mana | 2.0/5: 40% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield, sacred_shield_tick
1:16.632 holy_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield, sacred_shield_tick
1:17.945 judgment Fluffy_Pillow 30400.0/32000: 95% mana | 2.0/5: 40% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield, sacred_shield_tick
1:19.258 potion Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power alabaster_shield, bastion_of_glory(5), sacred_shield
1:19.258 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power alabaster_shield, bastion_of_glory(5), draenic_armor_potion, sacred_shield
1:20.573 consecration Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power alabaster_shield, bastion_of_glory(5), tectus_heartbeat, draenic_armor_potion, sacred_shield
1:21.888 sacred_shield Zambo 29760.0/32000: 93% mana | 4.0/5: 80% holy_power alabaster_shield, bastion_of_glory(5), tectus_heartbeat, draenic_armor_potion, sacred_shield
1:23.201 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power alabaster_shield, bastion_of_glory(5), tectus_heartbeat, draenic_armor_potion, sacred_shield
1:23.201 shield_of_the_righteous Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power bastion_of_glory(5), grand_crusader, shield_of_the_righteous, tectus_heartbeat, draenic_armor_potion, sacred_shield
1:24.515 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power alabaster_shield, bastion_of_glory(5), grand_crusader, shield_of_the_righteous, tectus_heartbeat, draenic_armor_potion, sacred_shield
1:25.827 avengers_shield Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power alabaster_shield, bastion_of_glory(5), grand_crusader, shield_of_the_righteous, tectus_heartbeat, draenic_armor_potion, sacred_shield
1:27.141 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power alabaster_shield, bastion_of_glory(5), tectus_heartbeat, draenic_armor_potion, sacred_shield
1:27.141 shield_of_the_righteous Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power divine_purpose, bastion_of_glory(5), grand_crusader, shield_of_the_righteous, tectus_heartbeat, draenic_armor_potion, sacred_shield
1:28.455 shield_of_the_righteous Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power divine_purpose, bastion_of_glory(5), grand_crusader, shield_of_the_righteous, tectus_heartbeat, draenic_armor_potion, sacred_shield
1:28.455 avengers_shield Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bastion_of_glory(5), grand_crusader, shield_of_the_righteous, tectus_heartbeat, draenic_armor_potion, sacred_shield
1:29.767 judgment Fluffy_Pillow 29760.0/32000: 93% mana | 3.0/5: 60% holy_power bastion_of_glory(5), shield_of_the_righteous, draenic_armor_potion, sacred_shield
1:30.067 divine_protection Fluffy_Pillow 28640.0/32000: 90% mana | 4.0/5: 80% holy_power divine_protection, bastion_of_glory(5), shield_of_the_righteous, draenic_armor_potion, sacred_shield
1:31.081 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power divine_protection, bastion_of_glory(5), shield_of_the_righteous, draenic_armor_potion, sacred_shield, sacred_shield_tick
1:31.081 shield_of_the_righteous Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power divine_protection, bastion_of_glory(5), shield_of_the_righteous, draenic_armor_potion, sacred_shield, sacred_shield_tick
1:32.395 consecration Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power divine_protection, bastion_of_glory(5), shield_of_the_righteous, draenic_armor_potion, sacred_shield
1:33.708 holy_wrath Fluffy_Pillow 29760.0/32000: 93% mana | 2.0/5: 40% holy_power divine_protection, bastion_of_glory(5), shield_of_the_righteous, draenic_armor_potion, sacred_shield
1:35.022 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power divine_protection, bastion_of_glory(5), shield_of_the_righteous, draenic_armor_potion, sacred_shield
1:36.335 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power alabaster_shield, divine_protection, bastion_of_glory(5), draenic_armor_potion, sacred_shield
1:37.648 sacred_shield Zambo 32000.0/32000: 100% mana | 4.0/5: 80% holy_power alabaster_shield, divine_protection, bastion_of_glory(5), draenic_armor_potion, sacred_shield
1:38.962 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power alabaster_shield(2), bastion_of_glory(5), draenic_armor_potion, sacred_shield
1:38.962 shield_of_the_righteous Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power divine_purpose, bastion_of_glory(5), grand_crusader, shield_of_the_righteous, tectus_heartbeat, draenic_armor_potion, sacred_shield
1:40.274 shield_of_the_righteous Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power divine_purpose, bastion_of_glory(5), grand_crusader, shield_of_the_righteous, tectus_heartbeat, draenic_armor_potion, sacred_shield
1:40.274 avengers_shield Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bastion_of_glory(5), grand_crusader, shield_of_the_righteous, tectus_heartbeat, draenic_armor_potion, sacred_shield
1:41.587 judgment Fluffy_Pillow 29760.0/32000: 93% mana | 3.0/5: 60% holy_power bastion_of_glory(5), shield_of_the_righteous, tectus_heartbeat, draenic_armor_potion, sacred_shield
1:42.900 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power alabaster_shield, bastion_of_glory(5), shield_of_the_righteous, tectus_heartbeat, draenic_armor_potion, sacred_shield
1:42.900 shield_of_the_righteous Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power bastion_of_glory(5), shield_of_the_righteous, tectus_heartbeat, draenic_armor_potion, sacred_shield
1:44.215 consecration Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bastion_of_glory(5), shield_of_the_righteous, tectus_heartbeat, draenic_armor_potion, sacred_shield
1:45.528 sacred_shield Zambo 29760.0/32000: 93% mana | 2.0/5: 40% holy_power bastion_of_glory(5), shield_of_the_righteous, tectus_heartbeat, sacred_shield
1:46.843 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bastion_of_glory(5), shield_of_the_righteous, tectus_heartbeat, sacred_shield
1:48.043 shield_of_the_righteous Fluffy_Pillow 31360.0/32000: 98% mana | 0.0/5: 0% holy_power bastion_of_glory(5), grand_crusader, shield_of_the_righteous, tectus_heartbeat, sacred_shield
1:48.156 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power bastion_of_glory(5), grand_crusader, shield_of_the_righteous, tectus_heartbeat, sacred_shield
1:49.469 avengers_shield Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bastion_of_glory(5), grand_crusader, shield_of_the_righteous, sacred_shield
1:50.782 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
1:52.096 consecration Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bastion_of_glory(5), sacred_shield
1:53.409 judgment Fluffy_Pillow 29760.0/32000: 93% mana | 3.0/5: 60% holy_power bastion_of_glory(5), sacred_shield
1:54.009 shield_of_the_righteous Fluffy_Pillow 29760.0/32000: 93% mana | 1.0/5: 20% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
1:54.724 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
1:56.037 holy_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
1:57.349 sacred_shield Zambo 30400.0/32000: 95% mana | 2.0/5: 40% holy_power bastion_of_glory(5), sacred_shield, sacred_shield_tick
1:58.662 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bastion_of_glory(5), sacred_shield
1:59.975 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 3.0/5: 60% holy_power bastion_of_glory(5), sacred_shield
2:00.075 divine_protection Fluffy_Pillow 30240.0/32000: 95% mana | 4.0/5: 80% holy_power divine_protection, bastion_of_glory(5), sacred_shield
2:00.075 shield_of_the_righteous Fluffy_Pillow 30240.0/32000: 95% mana | 1.0/5: 20% holy_power divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
2:01.288 consecration Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
2:02.601 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
2:03.915 avengers_shield Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power divine_protection, bastion_of_glory(5), sacred_shield
2:05.229 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power divine_protection, bastion_of_glory(5), sacred_shield
2:05.229 shield_of_the_righteous Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
2:06.541 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power alabaster_shield, divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
2:07.853 lights_hammer Fluffy_Pillow 31360.0/32000: 98% mana | 1.0/5: 20% holy_power alabaster_shield, divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield, sacred_shield_tick
2:09.166 consecration Fluffy_Pillow 19552.0/32000: 61% mana | 1.0/5: 20% holy_power alabaster_shield, bastion_of_glory(5), sacred_shield
2:10.479 crusader_strike Fluffy_Pillow 22112.0/32000: 69% mana | 1.0/5: 20% holy_power alabaster_shield, bastion_of_glory(5), sacred_shield
2:11.792 judgment Fluffy_Pillow 21472.0/32000: 67% mana | 2.0/5: 40% holy_power alabaster_shield, bastion_of_glory(5), sacred_shield
2:12.592 shield_of_the_righteous Fluffy_Pillow 21472.0/32000: 67% mana | 0.0/5: 0% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
2:13.105 holy_wrath Fluffy_Pillow 26272.0/32000: 82% mana | 0.0/5: 0% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
2:14.420 crusader_strike Fluffy_Pillow 29472.0/32000: 92% mana | 0.0/5: 0% holy_power alabaster_shield, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
2:15.733 avengers_shield Fluffy_Pillow 28832.0/32000: 90% mana | 1.0/5: 20% holy_power alabaster_shield, bastion_of_glory(5), grand_crusader, sacred_shield
2:17.045 judgment Fluffy_Pillow 31392.0/32000: 98% mana | 2.0/5: 40% holy_power alabaster_shield(2), bastion_of_glory(5), sacred_shield
2:18.359 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power alabaster_shield(2), bastion_of_glory(5), sacred_shield
2:18.559 shield_of_the_righteous Fluffy_Pillow 31360.0/32000: 98% mana | 1.0/5: 20% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
2:19.673 consecration Fluffy_Pillow 31360.0/32000: 98% mana | 1.0/5: 20% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
2:20.986 sacred_shield Zambo 32000.0/32000: 100% mana | 1.0/5: 20% holy_power alabaster_shield, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
2:22.301 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power alabaster_shield, bastion_of_glory(5), sacred_shield
2:23.614 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power alabaster_shield, bastion_of_glory(5), sacred_shield, sacred_shield_tick
2:24.927 Waiting 1.000 sec 32000.0/32000: 100% mana | 3.0/5: 60% holy_power alabaster_shield, bastion_of_glory(5), sacred_shield
2:25.927 wait Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power alabaster_shield, bastion_of_glory(5), sacred_shield
2:26.229 shield_of_the_righteous Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power alabaster_shield, bastion_of_glory(5), sacred_shield
2:26.229 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
2:27.543 consecration Fluffy_Pillow 31360.0/32000: 98% mana | 1.0/5: 20% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
2:28.856 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power alabaster_shield, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
2:30.156 divine_protection Fluffy_Pillow 30880.0/32000: 97% mana | 2.0/5: 40% holy_power alabaster_shield(2), divine_protection, bastion_of_glory(5), sacred_shield
2:30.170 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power alabaster_shield(2), divine_protection, bastion_of_glory(5), sacred_shield
2:31.483 avengers_shield Fluffy_Pillow 31360.0/32000: 98% mana | 3.0/5: 60% holy_power alabaster_shield(2), divine_protection, bastion_of_glory(5), sacred_shield
2:32.798 holy_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power alabaster_shield(3), divine_protection, bastion_of_glory(5), sacred_shield
2:34.098 shield_of_the_righteous Fluffy_Pillow 30400.0/32000: 95% mana | 0.0/5: 0% holy_power divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
2:34.110 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
2:35.423 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 1.0/5: 20% holy_power divine_protection, bastion_of_glory(5), grand_crusader, shield_of_the_righteous, sacred_shield
2:36.735 avengers_shield Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power divine_protection, bastion_of_glory(5), grand_crusader, shield_of_the_righteous, sacred_shield
2:38.051 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power alabaster_shield, divine_protection, bastion_of_glory(5), sacred_shield
2:39.365 consecration Fluffy_Pillow 31360.0/32000: 98% mana | 4.0/5: 80% holy_power alabaster_shield, bastion_of_glory(5), sacred_shield, sacred_shield_tick
2:40.679 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power alabaster_shield, bastion_of_glory(5), sacred_shield
2:40.679 shield_of_the_righteous Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
2:41.991 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
2:43.306 sacred_shield Zambo 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
2:44.619 Waiting 1.000 sec 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bastion_of_glory(5), sacred_shield
2:45.619 wait Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bastion_of_glory(5), sacred_shield
2:45.919 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bastion_of_glory(5), sacred_shield
2:47.233 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power alabaster_shield, bastion_of_glory(5), grand_crusader, sacred_shield
2:47.233 shield_of_the_righteous Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bastion_of_glory(5), grand_crusader, shield_of_the_righteous, sacred_shield
2:48.548 avengers_shield Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bastion_of_glory(5), grand_crusader, shield_of_the_righteous, sacred_shield
2:48.548 shield_of_the_righteous Fluffy_Pillow 29760.0/32000: 93% mana | 0.0/5: 0% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
2:49.862 crusader_strike Fluffy_Pillow 29760.0/32000: 93% mana | 0.0/5: 0% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
2:51.174 consecration Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power alabaster_shield, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
2:52.489 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power alabaster_shield, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
2:53.802 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power alabaster_shield, bastion_of_glory(5), sacred_shield
2:54.002 shield_of_the_righteous Fluffy_Pillow 31360.0/32000: 98% mana | 0.0/5: 0% holy_power bastion_of_glory(5), grand_crusader, shield_of_the_righteous, sacred_shield
2:55.115 avengers_shield Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power bastion_of_glory(5), grand_crusader, shield_of_the_righteous, sacred_shield, sacred_shield_tick
2:56.429 avengers_shield Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bastion_of_glory(5), grand_crusader, shield_of_the_righteous, sacred_shield, sacred_shield_tick
2:57.742 crusader_strike Fluffy_Pillow 29760.0/32000: 93% mana | 2.0/5: 40% holy_power bastion_of_glory(5), sacred_shield
2:58.042 shield_of_the_righteous Fluffy_Pillow 29120.0/32000: 91% mana | 0.0/5: 0% holy_power divine_purpose, bastion_of_glory(5), grand_crusader, shield_of_the_righteous, sacred_shield
2:59.056 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power divine_purpose, bastion_of_glory(5), grand_crusader, shield_of_the_righteous, sacred_shield
2:59.356 shield_of_the_righteous Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power divine_purpose, bastion_of_glory(5), grand_crusader, shield_of_the_righteous, sacred_shield, sacred_shield_tick
3:00.156 divine_protection Fluffy_Pillow 30880.0/32000: 97% mana | 1.0/5: 20% holy_power divine_purpose, divine_protection, bastion_of_glory(5), grand_crusader, shield_of_the_righteous, sacred_shield, sacred_shield_tick
3:00.369 avengers_shield Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power divine_purpose, divine_protection, bastion_of_glory(5), grand_crusader, shield_of_the_righteous, sacred_shield, sacred_shield_tick
3:00.669 shield_of_the_righteous Fluffy_Pillow 29760.0/32000: 93% mana | 2.0/5: 40% holy_power divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield, sacred_shield_tick
3:01.683 crusader_strike Fluffy_Pillow 29760.0/32000: 93% mana | 2.0/5: 40% holy_power divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield, sacred_shield_tick
3:02.997 consecration Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power alabaster_shield, divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
3:04.097 shield_of_the_righteous Fluffy_Pillow 29760.0/32000: 93% mana | 0.0/5: 0% holy_power divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
3:04.312 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
3:05.627 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield, sacred_shield_tick
3:06.942 holy_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield, sacred_shield_tick
3:08.255 lights_hammer Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
3:09.568 crusader_strike Fluffy_Pillow 15392.0/32000: 48% mana | 2.0/5: 40% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
3:10.068 guardian_of_ancient_kings Fluffy_Pillow 14752.0/32000: 46% mana | 3.0/5: 60% holy_power bastion_of_glory(5), guardian_of_ancient_kings, sacred_shield
3:10.882 judgment Fluffy_Pillow 19552.0/32000: 61% mana | 3.0/5: 60% holy_power bastion_of_glory(5), guardian_of_ancient_kings, sacred_shield
3:12.195 consecration Fluffy_Pillow 24352.0/32000: 76% mana | 4.0/5: 80% holy_power bastion_of_glory(5), guardian_of_ancient_kings, sacred_shield
3:13.510 crusader_strike Fluffy_Pillow 22112.0/32000: 69% mana | 4.0/5: 80% holy_power bastion_of_glory(5), guardian_of_ancient_kings
3:13.510 shield_of_the_righteous Fluffy_Pillow 21472.0/32000: 67% mana | 2.0/5: 40% holy_power bastion_of_glory(5), guardian_of_ancient_kings, shield_of_the_righteous
3:14.823 avengers_shield Fluffy_Pillow 26272.0/32000: 82% mana | 2.0/5: 40% holy_power alabaster_shield, bastion_of_glory(5), guardian_of_ancient_kings, shield_of_the_righteous
3:16.138 judgment Fluffy_Pillow 28832.0/32000: 90% mana | 2.0/5: 40% holy_power alabaster_shield, bastion_of_glory(5), guardian_of_ancient_kings, shield_of_the_righteous
3:17.452 crusader_strike Fluffy_Pillow 28832.0/32000: 90% mana | 3.0/5: 60% holy_power alabaster_shield, bastion_of_glory(5), guardian_of_ancient_kings
3:18.152 ardent_defender Fluffy_Pillow 28192.0/32000: 88% mana | 4.0/5: 80% holy_power alabaster_shield, bastion_of_glory(5), ardent_defender
3:18.765 sacred_shield Zambo 32000.0/32000: 100% mana | 4.0/5: 80% holy_power alabaster_shield, bastion_of_glory(5), ardent_defender
3:20.077 consecration Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power alabaster_shield(2), bastion_of_glory(5), sacred_shield
3:21.391 crusader_strike Fluffy_Pillow 29760.0/32000: 93% mana | 4.0/5: 80% holy_power alabaster_shield(2), bastion_of_glory(5), sacred_shield, sacred_shield_tick
3:21.391 shield_of_the_righteous Fluffy_Pillow 29120.0/32000: 91% mana | 2.0/5: 40% holy_power bastion_of_glory(5), grand_crusader, shield_of_the_righteous, sacred_shield, sacred_shield_tick
3:22.704 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bastion_of_glory(5), grand_crusader, shield_of_the_righteous, sacred_shield
3:24.017 avengers_shield Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bastion_of_glory(5), grand_crusader, shield_of_the_righteous, sacred_shield
3:25.332 crusader_strike Fluffy_Pillow 29760.0/32000: 93% mana | 4.0/5: 80% holy_power bastion_of_glory(5), sacred_shield
3:25.332 shield_of_the_righteous Fluffy_Pillow 29120.0/32000: 91% mana | 2.0/5: 40% holy_power divine_purpose, bastion_of_glory(5), grand_crusader, shield_of_the_righteous, sacred_shield
3:26.645 shield_of_the_righteous Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power divine_purpose, bastion_of_glory(5), grand_crusader, shield_of_the_righteous, sacred_shield, sacred_shield_tick
3:26.645 avengers_shield Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bastion_of_glory(5), grand_crusader, shield_of_the_righteous, sacred_shield, sacred_shield_tick
3:27.959 judgment Fluffy_Pillow 29760.0/32000: 93% mana | 3.0/5: 60% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
3:29.274 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
3:29.274 shield_of_the_righteous Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
3:30.174 divine_protection Fluffy_Pillow 30240.0/32000: 95% mana | 2.0/5: 40% holy_power divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
3:30.587 consecration Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
3:31.900 holy_wrath Fluffy_Pillow 29760.0/32000: 93% mana | 2.0/5: 40% holy_power divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
3:33.214 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
3:33.214 shield_of_the_righteous Fluffy_Pillow 31360.0/32000: 98% mana | 0.0/5: 0% holy_power divine_purpose, divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
3:34.527 shield_of_the_righteous Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power alabaster_shield, divine_purpose, divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
3:34.527 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
3:35.839 sacred_shield Zambo 32000.0/32000: 100% mana | 1.0/5: 20% holy_power divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
3:37.153 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power divine_protection, bastion_of_glory(5), shield_of_the_righteous, tectus_heartbeat, sacred_shield, sacred_shield_tick
3:38.466 avengers_shield Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bastion_of_glory(5), grand_crusader, shield_of_the_righteous, tectus_heartbeat, sacred_shield, sacred_shield_tick
3:39.779 judgment Fluffy_Pillow 29760.0/32000: 93% mana | 3.0/5: 60% holy_power bastion_of_glory(5), shield_of_the_righteous, tectus_heartbeat, sacred_shield
3:41.092 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power bastion_of_glory(5), tectus_heartbeat, sacred_shield
3:41.092 shield_of_the_righteous Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power bastion_of_glory(5), grand_crusader, shield_of_the_righteous, tectus_heartbeat, sacred_shield
3:42.405 avengers_shield Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power alabaster_shield, bastion_of_glory(5), grand_crusader, shield_of_the_righteous, tectus_heartbeat, sacred_shield
3:43.718 consecration Fluffy_Pillow 29760.0/32000: 93% mana | 3.0/5: 60% holy_power alabaster_shield, bastion_of_glory(5), shield_of_the_righteous, tectus_heartbeat, sacred_shield
3:45.032 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power alabaster_shield, bastion_of_glory(5), grand_crusader, tectus_heartbeat, sacred_shield
3:46.346 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power alabaster_shield(2), bastion_of_glory(5), grand_crusader, tectus_heartbeat, sacred_shield
3:46.346 shield_of_the_righteous Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bastion_of_glory(5), grand_crusader, shield_of_the_righteous, tectus_heartbeat, sacred_shield
3:47.660 avengers_shield Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bastion_of_glory(5), grand_crusader, shield_of_the_righteous, sacred_shield, sacred_shield_tick
3:48.975 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
3:50.288 holy_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power bastion_of_glory(5), sacred_shield
3:51.603 judgment Fluffy_Pillow 30400.0/32000: 95% mana | 4.0/5: 80% holy_power bastion_of_glory(5), sacred_shield
3:51.603 shield_of_the_righteous Fluffy_Pillow 30400.0/32000: 95% mana | 2.0/5: 40% holy_power divine_purpose, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
3:52.918 shield_of_the_righteous Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power alabaster_shield, divine_purpose, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
3:52.918 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power divine_purpose, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
3:54.231 shield_of_the_righteous Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power alabaster_shield, divine_purpose, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
3:54.231 consecration Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
3:55.545 sacred_shield Zambo 29760.0/32000: 93% mana | 3.0/5: 60% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
3:56.858 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power alabaster_shield, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
3:58.171 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power alabaster_shield(2), bastion_of_glory(5), grand_crusader, shield_of_the_righteous, sacred_shield, sacred_shield_tick
3:58.171 shield_of_the_righteous Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bastion_of_glory(5), grand_crusader, shield_of_the_righteous, sacred_shield, sacred_shield_tick
3:59.483 avengers_shield Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bastion_of_glory(5), grand_crusader, shield_of_the_righteous, sacred_shield, sacred_shield_tick
4:00.183 divine_protection Fluffy_Pillow 28640.0/32000: 90% mana | 3.0/5: 60% holy_power alabaster_shield, divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
4:00.798 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power alabaster_shield, divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
4:02.098 shield_of_the_righteous Fluffy_Pillow 31360.0/32000: 98% mana | 1.0/5: 20% holy_power divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
4:02.111 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield, sacred_shield_tick
4:03.424 judgment Fluffy_Pillow 31040.0/32000: 97% mana | 1.0/5: 20% holy_power divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield, sacred_shield_tick
4:04.737 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power alabaster_shield, divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
4:06.050 holy_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power alabaster_shield(2), divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
4:07.365 hammer_of_wrath Fluffy_Pillow 30400.0/32000: 95% mana | 3.0/5: 60% holy_power alabaster_shield(2), divine_protection, bastion_of_glory(5), sacred_shield, sacred_shield_tick
4:08.165 shield_of_the_righteous Fluffy_Pillow 29440.0/32000: 92% mana | 0.0/5: 0% holy_power divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
4:08.678 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
4:09.993 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 1.0/5: 20% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
4:11.307 lights_hammer Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power alabaster_shield, bastion_of_glory(5), sacred_shield
4:12.620 crusader_strike Fluffy_Pillow 20192.0/32000: 63% mana | 2.0/5: 40% holy_power alabaster_shield, bastion_of_glory(5), sacred_shield, sacred_shield_tick
4:13.933 avengers_shield Fluffy_Pillow 19552.0/32000: 61% mana | 3.0/5: 60% holy_power alabaster_shield, bastion_of_glory(5), sacred_shield, sacred_shield_tick
4:15.246 judgment Fluffy_Pillow 22112.0/32000: 69% mana | 3.0/5: 60% holy_power alabaster_shield, bastion_of_glory(5), sacred_shield, sacred_shield_tick
4:16.046 shield_of_the_righteous Fluffy_Pillow 22112.0/32000: 69% mana | 1.0/5: 20% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
4:16.560 crusader_strike Fluffy_Pillow 26912.0/32000: 84% mana | 1.0/5: 20% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
4:17.873 hammer_of_wrath Fluffy_Pillow 26272.0/32000: 82% mana | 2.0/5: 40% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield, sacred_shield_tick
4:19.185 holy_wrath Fluffy_Pillow 30112.0/32000: 94% mana | 2.0/5: 40% holy_power alabaster_shield, bastion_of_glory(5), sacred_shield
4:20.498 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power alabaster_shield(2), bastion_of_glory(5), sacred_shield
4:21.811 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 3.0/5: 60% holy_power alabaster_shield(2), bastion_of_glory(5), sacred_shield
4:23.126 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power alabaster_shield(3), bastion_of_glory(5), sacred_shield, sacred_shield_tick
4:24.439 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power alabaster_shield(3), bastion_of_glory(5), sacred_shield
4:24.439 shield_of_the_righteous Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
4:25.754 consecration Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power bastion_of_glory(5), shield_of_the_righteous
4:27.067 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bastion_of_glory(5), shield_of_the_righteous, tectus_heartbeat
4:27.067 shield_of_the_righteous Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power bastion_of_glory(5), shield_of_the_righteous, tectus_heartbeat
4:28.380 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power bastion_of_glory(5), shield_of_the_righteous, tectus_heartbeat, sacred_shield_tick
4:29.694 avengers_shield Fluffy_Pillow 31360.0/32000: 98% mana | 1.0/5: 20% holy_power bastion_of_glory(5), shield_of_the_righteous, tectus_heartbeat
4:30.194 divine_protection Fluffy_Pillow 28000.0/32000: 88% mana | 1.0/5: 20% holy_power divine_protection, bastion_of_glory(5), shield_of_the_righteous, tectus_heartbeat
4:31.007 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power divine_protection, bastion_of_glory(5), tectus_heartbeat
4:32.320 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power alabaster_shield, divine_protection, bastion_of_glory(5), tectus_heartbeat
4:33.633 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power alabaster_shield, divine_protection, bastion_of_glory(5), tectus_heartbeat, sacred_shield_tick
4:34.947 sacred_shield Zambo 32000.0/32000: 100% mana | 3.0/5: 60% holy_power alabaster_shield(2), divine_protection, bastion_of_glory(5), tectus_heartbeat, sacred_shield_tick
4:36.261 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power alabaster_shield(2), divine_protection, bastion_of_glory(5), tectus_heartbeat, sacred_shield
4:37.575 holy_wrath Fluffy_Pillow 31360.0/32000: 98% mana | 4.0/5: 80% holy_power alabaster_shield(2), divine_protection, bastion_of_glory(5), sacred_shield
4:38.075 shield_of_the_righteous Fluffy_Pillow 29760.0/32000: 93% mana | 1.0/5: 20% holy_power divine_protection, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
4:38.890 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
4:40.205 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield, sacred_shield_tick
4:41.520 hammer_of_wrath Fluffy_Pillow 31360.0/32000: 98% mana | 3.0/5: 60% holy_power bastion_of_glory(5), sacred_shield, sacred_shield_tick
4:42.830 avengers_shield Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bastion_of_glory(5), sacred_shield
4:44.144 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power alabaster_shield, bastion_of_glory(5), sacred_shield
4:45.458 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 4.0/5: 80% holy_power alabaster_shield, bastion_of_glory(5), sacred_shield, sacred_shield_tick
4:45.458 shield_of_the_righteous Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield, sacred_shield_tick
4:46.772 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
4:48.085 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power alabaster_shield, bastion_of_glory(5), shield_of_the_righteous, sacred_shield
4:49.399 consecration Fluffy_Pillow 31360.0/32000: 98% mana | 3.0/5: 60% holy_power alabaster_shield, bastion_of_glory(5), sacred_shield
4:50.099 shield_of_the_righteous Fluffy_Pillow 29120.0/32000: 91% mana | 0.0/5: 0% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield
4:50.712 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power bastion_of_glory(5), shield_of_the_righteous, sacred_shield, sacred_shield_tick
4:52.026 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bastion_of_glory(5), shield_of_the_righteous, tectus_heartbeat, sacred_shield
4:53.340 avengers_shield Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power bastion_of_glory(5), grand_crusader, tectus_heartbeat, sacred_shield
4:54.040 shield_of_the_righteous Fluffy_Pillow 29120.0/32000: 91% mana | 0.0/5: 0% holy_power divine_purpose, bastion_of_glory(5), shield_of_the_righteous, tectus_heartbeat, sacred_shield
4:54.654 holy_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power divine_purpose, bastion_of_glory(5), shield_of_the_righteous, tectus_heartbeat, sacred_shield
4:55.354 shield_of_the_righteous Fluffy_Pillow 30400.0/32000: 95% mana | 0.0/5: 0% holy_power bastion_of_glory(5), shield_of_the_righteous, tectus_heartbeat, sacred_shield
4:55.967 crusader_strike Fluffy_Pillow 30400.0/32000: 95% mana | 0.0/5: 0% holy_power bastion_of_glory(5), shield_of_the_righteous, tectus_heartbeat, sacred_shield, sacred_shield_tick

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4317 4112 4112 (1629)
Agility 477 455 455
Stamina 6239 5084 4255
Intellect 1094 1042 1042
Spirit 782 782 782
Health 374340 305040 0
Mana 32000 32000 0
Holy Power 5 5 0
Spell Power 6052 5036 0
Crit 13.77% 8.77% 415
Haste 14.56% 9.10% 910
Multistrike 10.14% 5.14% 339
Damage / Heal Versatility 6.88% 3.88% 505
Mitigation Versatility 3.44% 1.94% 505
Attack Power 6052 5036 0
Mastery 24.40% 19.40% 1254
Armor 2899 2899 2793
Bonus Armor 106 106 106
Avoidance 0 0 172
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 5.00% 5.00% 0
Tank-Parry 22.47% 21.35% 415
Tank-Block 46.28% 42.11% 0
Tank-Crit -6.00% -6.00% 0

Talents

Level
15 Speed of Light Long Arm of the Law Pursuit of Justice
30 Fist of Justice Repentance Blinding Light
45 Selfless Healer Eternal Flame Sacred Shield (Protection Paladin)
60 Hand of Purity Unbreakable Spirit Clemency
75 Holy Avenger Sanctified Wrath (Protection Paladin) Divine Purpose
90 Holy Prism Light's Hammer Execution Sentence
100 Empowered Seals Seraphim Holy Shield

Profile

paladin="Zambo"
origin="http://eu.battle.net/wow/en/character/dalvengyr/Zambo/advanced"
thumbnail="http://eu.battle.net/static-render/eu/nazjatar/126/78079358-avatar.jpg"
level=100
race=human
role=tank
position=front
professions=blacksmithing=700/mining=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#bZ!2021212
glyphs=alabaster_shield/final_wrath/consecrator/pillar_of_light/contemplation
spec=protection

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_stamina_flask
actions.precombat+=/food,type=talador_surf_and_turf
actions.precombat+=/blessing_of_kings,if=(!aura.str_agi_int.up)&(aura.mastery.up)
actions.precombat+=/blessing_of_might,if=!aura.mastery.up
actions.precombat+=/seal_of_insight
actions.precombat+=/sacred_shield
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=draenic_armor

# Executed every time the actor is available.

actions=/auto_attack
actions+=/speed_of_light,if=movement.remains>1
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
# This line will shortcut to a high-DPS (but low-survival) action list. Change 0 to 1 if you want to do this all the time.
actions+=/run_action_list,name=max_dps,if=role.attack|0
# This line will shortcut to a high-survival (but low-DPS) action list. Change 0 to 1 if you want it to do this all the time.
actions+=/run_action_list,name=max_survival,if=0
actions+=/potion,name=draenic_armor,if=buff.shield_of_the_righteous.down&buff.seraphim.down&buff.divine_protection.down&buff.guardian_of_ancient_kings.down&buff.ardent_defender.down
# Standard survival priority list starts here
# This section covers off-GCD spells.
actions+=/holy_avenger
actions+=/seraphim
actions+=/divine_protection,if=time<5|!talent.seraphim.enabled|(buff.seraphim.down&cooldown.seraphim.remains>5&cooldown.seraphim.remains<9)
actions+=/guardian_of_ancient_kings,if=time<5|(buff.holy_avenger.down&buff.shield_of_the_righteous.down&buff.divine_protection.down)
actions+=/ardent_defender,if=time<5|(buff.holy_avenger.down&buff.shield_of_the_righteous.down&buff.divine_protection.down&buff.guardian_of_ancient_kings.down)
actions+=/eternal_flame,if=buff.eternal_flame.remains<2&buff.bastion_of_glory.react>2&(holy_power>=3|buff.divine_purpose.react|buff.bastion_of_power.react)
actions+=/eternal_flame,if=buff.bastion_of_power.react&buff.bastion_of_glory.react>=5
actions+=/harsh_word,if=glyph.harsh_words.enabled&holy_power>=3
actions+=/shield_of_the_righteous,if=buff.divine_purpose.react
actions+=/shield_of_the_righteous,if=(holy_power>=5|incoming_damage_1500ms>=health.max*0.3)&(!talent.seraphim.enabled|cooldown.seraphim.remains>5)
actions+=/shield_of_the_righteous,if=buff.holy_avenger.remains>time_to_hpg&(!talent.seraphim.enabled|cooldown.seraphim.remains>time_to_hpg)
# GCD-bound spells start here
actions+=/seal_of_insight,if=talent.empowered_seals.enabled&!seal.insight&buff.uthers_insight.remains<cooldown.judgment.remains
actions+=/seal_of_righteousness,if=talent.empowered_seals.enabled&!seal.righteousness&buff.uthers_insight.remains>cooldown.judgment.remains&buff.liadrins_righteousness.down
actions+=/seal_of_truth,if=talent.empowered_seals.enabled&!seal.truth&buff.uthers_insight.remains>cooldown.judgment.remains&buff.liadrins_righteousness.remains>cooldown.judgment.remains&buff.maraads_truth.down
actions+=/avengers_shield,if=buff.grand_crusader.react&active_enemies>1&!glyph.focused_shield.enabled
actions+=/hammer_of_the_righteous,if=active_enemies>=3
actions+=/crusader_strike
actions+=/wait,sec=cooldown.crusader_strike.remains,if=cooldown.crusader_strike.remains>0&cooldown.crusader_strike.remains<=0.35
actions+=/judgment,cycle_targets=1,if=glyph.double_jeopardy.enabled&last_judgment_target!=target
actions+=/judgment
actions+=/wait,sec=cooldown.judgment.remains,if=cooldown.judgment.remains>0&cooldown.judgment.remains<=0.35
actions+=/avengers_shield,if=active_enemies>1&!glyph.focused_shield.enabled
actions+=/holy_wrath,if=talent.sanctified_wrath.enabled
actions+=/avengers_shield,if=buff.grand_crusader.react
actions+=/sacred_shield,if=target.dot.sacred_shield.remains<2
actions+=/holy_wrath,if=glyph.final_wrath.enabled&target.health.pct<=20
actions+=/avengers_shield
actions+=/lights_hammer,if=!talent.seraphim.enabled|buff.seraphim.remains>10|cooldown.seraphim.remains<6
actions+=/holy_prism,if=!talent.seraphim.enabled|buff.seraphim.up|cooldown.seraphim.remains>5|time<5
actions+=/consecration,if=target.debuff.flying.down&active_enemies>=3
actions+=/execution_sentence,if=!talent.seraphim.enabled|buff.seraphim.up|time<12
actions+=/hammer_of_wrath
actions+=/sacred_shield,if=target.dot.sacred_shield.remains<8
actions+=/consecration,if=target.debuff.flying.down
actions+=/holy_wrath
actions+=/seal_of_insight,if=talent.empowered_seals.enabled&!seal.insight&buff.uthers_insight.remains<=buff.liadrins_righteousness.remains&buff.uthers_insight.remains<=buff.maraads_truth.remains
actions+=/seal_of_righteousness,if=talent.empowered_seals.enabled&!seal.righteousness&buff.liadrins_righteousness.remains<=buff.uthers_insight.remains&buff.liadrins_righteousness.remains<=buff.maraads_truth.remains
actions+=/seal_of_truth,if=talent.empowered_seals.enabled&!seal.truth&buff.maraads_truth.remains<buff.uthers_insight.remains&buff.maraads_truth.remains<buff.liadrins_righteousness.remains
actions+=/sacred_shield
actions+=/flash_of_light,if=talent.selfless_healer.enabled&buff.selfless_healer.stack>=3

actions.max_dps=potion,name=draenic_armor,if=buff.holy_avenger.react|buff.bloodlust.react|target.time_to_die<=60
# Max-DPS priority list starts here.
# This section covers off-GCD spells.
actions.max_dps+=/holy_avenger
actions.max_dps+=/seraphim
actions.max_dps+=/shield_of_the_righteous,if=buff.divine_purpose.react
actions.max_dps+=/shield_of_the_righteous,if=(holy_power>=5|talent.holy_avenger.enabled)&(!talent.seraphim.enabled|cooldown.seraphim.remains>5)
actions.max_dps+=/shield_of_the_righteous,if=buff.holy_avenger.remains>time_to_hpg&(!talent.seraphim.enabled|cooldown.seraphim.remains>time_to_hpg)
# #GCD-bound spells start here.
actions.max_dps+=/avengers_shield,if=buff.grand_crusader.react&active_enemies>1&!glyph.focused_shield.enabled
actions.max_dps+=/holy_wrath,if=talent.sanctified_wrath.enabled&(buff.seraphim.react|(glyph.final_wrath.enabled&target.health.pct<=20))
actions.max_dps+=/hammer_of_the_righteous,if=active_enemies>=3
actions.max_dps+=/judgment,if=talent.empowered_seals.enabled&(buff.maraads_truth.down|buff.liadrins_righteousness.down)
actions.max_dps+=/crusader_strike
actions.max_dps+=/wait,sec=cooldown.crusader_strike.remains,if=cooldown.crusader_strike.remains>0&cooldown.crusader_strike.remains<=0.35
actions.max_dps+=/judgment,cycle_targets=1,if=glyph.double_jeopardy.enabled&last_judgment_target!=target
actions.max_dps+=/judgment
actions.max_dps+=/wait,sec=cooldown.judgment.remains,if=cooldown.judgment.remains>0&cooldown.judgment.remains<=0.35
actions.max_dps+=/avengers_shield,if=active_enemies>1&!glyph.focused_shield.enabled
actions.max_dps+=/holy_wrath,if=talent.sanctified_wrath.enabled
actions.max_dps+=/avengers_shield,if=buff.grand_crusader.react
actions.max_dps+=/execution_sentence,if=active_enemies<3
actions.max_dps+=/holy_wrath,if=glyph.final_wrath.enabled&target.health.pct<=20
actions.max_dps+=/avengers_shield
actions.max_dps+=/seal_of_truth,if=talent.empowered_seals.enabled&!seal.truth&buff.maraads_truth.remains<cooldown.judgment.remains
actions.max_dps+=/seal_of_righteousness,if=talent.empowered_seals.enabled&!seal.righteousness&buff.maraads_truth.remains>cooldown.judgment.remains&buff.liadrins_righteousness.down
actions.max_dps+=/lights_hammer
actions.max_dps+=/holy_prism
actions.max_dps+=/consecration,if=target.debuff.flying.down&active_enemies>=3
actions.max_dps+=/execution_sentence
actions.max_dps+=/hammer_of_wrath
actions.max_dps+=/consecration,if=target.debuff.flying.down
actions.max_dps+=/holy_wrath
actions.max_dps+=/seal_of_truth,if=talent.empowered_seals.enabled&!seal.truth&buff.maraads_truth.remains<buff.liadrins_righteousness.remains
actions.max_dps+=/seal_of_righteousness,if=talent.empowered_seals.enabled&!seal.righteousness&buff.liadrins_righteousness.remains<buff.maraads_truth.remains
actions.max_dps+=/sacred_shield
actions.max_dps+=/flash_of_light,if=talent.selfless_healer.enabled&buff.selfless_healer.stack>=3

actions.max_survival=potion,name=draenic_armor,if=buff.shield_of_the_righteous.down&buff.seraphim.down&buff.divine_protection.down&buff.guardian_of_ancient_kings.down&buff.ardent_defender.down
# Max survival priority list starts here
# This section covers off-GCD spells.
actions.max_survival+=/holy_avenger
actions.max_survival+=/divine_protection,if=time<5|!talent.seraphim.enabled|(buff.seraphim.down&cooldown.seraphim.remains>5&cooldown.seraphim.remains<9)
actions.max_survival+=/seraphim,if=buff.divine_protection.down&cooldown.divine_protection.remains>0
actions.max_survival+=/guardian_of_ancient_kings,if=buff.holy_avenger.down&buff.shield_of_the_righteous.down&buff.divine_protection.down
actions.max_survival+=/ardent_defender,if=buff.holy_avenger.down&buff.shield_of_the_righteous.down&buff.divine_protection.down&buff.guardian_of_ancient_kings.down
actions.max_survival+=/eternal_flame,if=buff.eternal_flame.remains<2&buff.bastion_of_glory.react>2&(holy_power>=3|buff.divine_purpose.react|buff.bastion_of_power.react)
actions.max_survival+=/eternal_flame,if=buff.bastion_of_power.react&buff.bastion_of_glory.react>=5
actions.max_survival+=/shield_of_the_righteous,if=buff.divine_purpose.react
actions.max_survival+=/shield_of_the_righteous,if=(holy_power>=5|incoming_damage_1500ms>=health.max*0.3)&(!talent.seraphim.enabled|cooldown.seraphim.remains>5)
actions.max_survival+=/shield_of_the_righteous,if=buff.holy_avenger.remains>time_to_hpg&(!talent.seraphim.enabled|cooldown.seraphim.remains>time_to_hpg)
actions.max_survival+=/hammer_of_the_righteous,if=active_enemies>=3
actions.max_survival+=/crusader_strike
actions.max_survival+=/wait,sec=cooldown.crusader_strike.remains,if=cooldown.crusader_strike.remains>0&cooldown.crusader_strike.remains<=0.35
actions.max_survival+=/judgment,cycle_targets=1,if=glyph.double_jeopardy.enabled&last_judgment_target!=target
actions.max_survival+=/judgment
actions.max_survival+=/wait,sec=cooldown.judgment.remains,if=cooldown.judgment.remains>0&cooldown.judgment.remains<=0.35
actions.max_survival+=/avengers_shield,if=buff.grand_crusader.react&active_enemies>1
actions.max_survival+=/holy_wrath,if=talent.sanctified_wrath.enabled
actions.max_survival+=/avengers_shield,if=buff.grand_crusader.react
actions.max_survival+=/sacred_shield,if=target.dot.sacred_shield.remains<2
actions.max_survival+=/avengers_shield
actions.max_survival+=/lights_hammer
actions.max_survival+=/holy_prism
actions.max_survival+=/consecration,if=target.debuff.flying.down&active_enemies>=3
actions.max_survival+=/execution_sentence
actions.max_survival+=/flash_of_light,if=talent.selfless_healer.enabled&buff.selfless_healer.stack>=3
actions.max_survival+=/hammer_of_wrath
actions.max_survival+=/sacred_shield,if=target.dot.sacred_shield.remains<8
actions.max_survival+=/holy_wrath,if=glyph.final_wrath.enabled&target.health.pct<=20
actions.max_survival+=/consecration,if=target.debuff.flying.down&!ticking
actions.max_survival+=/holy_wrath
actions.max_survival+=/sacred_shield

head=casque_of_the_iron_bomber,id=113600,bonus_id=566
neck=koraghs_family_locket,id=113841,bonus_id=560,enchant=75mastery
shoulders=botanibarbed_pauldrons,id=118892
back=cloak_of_ruminant_deception,id=113830,bonus_id=566,enchant=gift_of_mastery
chest=truesteel_breastplate,id=114232,bonus_id=181/526/534
wrists=bracers_of_mirrored_flame,id=113844,bonus_id=40
hands=gauntlets_of_the_heavy_hand,id=113632
waist=fleshchewer_greatbelt,id=113659,bonus_id=566
legs=legplates_of_fractured_crystal,id=113648,bonus_id=41
feet=entrail_squishers,id=113633,bonus_id=564/566,gems=50mastery
finger1=timeless_solium_band_of_the_bulwark,id=118298,enchant=30haste
finger2=grunts_solid_signet,id=113599,enchant=50mastery
trinket1=grandiose_carnage,id=114552,bonus_id=560
trinket2=tectus_beating_heart,id=113645,bonus_id=40/566
main_hand=grandiose_axe,id=115327,bonus_id=122/560,enchant=mark_of_the_shattered_hand
off_hand=absaloms_bloody_bulwark,id=113666

# Gear Summary
# gear_strength=2657
# gear_stamina=3321
# gear_crit_rating=415
# gear_haste_rating=867
# gear_mastery_rating=1254
# gear_armor=2793
# gear_bonus_armor=106
# gear_multistrike_rating=339
# gear_versatility_rating=405
# gear_leech_rating=120
# gear_avoidance_rating=172

Ðepeche

Ðepeche : 24835 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
24835.5 24835.5 9.8 / 0.039% 3040.5 / 12.2% 47.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
523.9 523.9 Mana 2.29% 49.5 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Ðepeche/advanced
Talents
  • 15: Pursuit of Justice
  • 30: Fist of Justice
  • 45: Selfless Healer
  • 60: Unbreakable Spirit
  • 75: Sanctified Wrath
  • 90: Execution Sentence
  • 100: Final Verdict (Retribution Paladin)
  • Talent Calculator
Glyphs
  • Glyph of Hand of Sacrifice
  • Glyph of Double Jeopardy
  • Glyph of Templar's Verdict
  • Glyph of Seal of Blood
  • Glyph of Winged Vengeance
  • Glyph of Righteous Retreat
Professions
  • blacksmithing: 700
  • jewelcrafting: 700

Charts

http://7.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=%C3%90epeche+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x270&chd=t:51859|20223|19509|17182|8359|7814|6394|2449&chds=0,103719&chco=FFE57F,FFE57F,FFE57F,FFE57F,FFE57F,FFE57F,C79C6E,C79C6E&chm=t++51859++execution_sentence,FFE57F,0,0,15|t++20223++final_verdict,FFE57F,1,0,15|t++19509++divine_storm,FFE57F,2,0,15|t++17182++hammer_of_wrath,FFE57F,3,0,15|t++8359++exorcism,FFE57F,4,0,15|t++7814++judgment,FFE57F,5,0,15|t++6394++crusader_strike,C79C6E,6,0,15|t++2449++melee,C79C6E,7,0,15& http://8.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=%C3%90epeche+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:24,18,15,10,7,6,5,5,5,3,2,1&chds=0,100&chdls=ffffff&chco=FFE57F,FFE57F,FFE57F,C79C6E,C79C6E,FFE57F,FFE57F,FFE57F,FFE57F,FFE57F,C79C6E,FFE57F&chl=hand_of_light|final_verdict|hammer_of_wrath|melee|crusader_strike|seal_of_truth_proc|divine_storm|execution_sentence|judgment|censure|shattered_bleed|exorcism&
http://0.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=%C3%90epeche+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:filoruwz257787545310xwutrqpnmkjihfedbaZYYXWWWWVVUUTSTTUTUUUUUWXWWWWWWWXYWWWXWWWVUTTTUTTUTTUTUUTTUTTUUUUUTUTTTUTTUVWXZaddfikknnpqrsuvvvwwuuttrpnomkjiigfeecbaaYXXWVVVVWUUVVUVUUVUUVWVWXYXYXYYYYZZZZZZZYYZXXXXWXXXXXWXXXXXXXXXXYXXYYXYYYYXXYYYZbbbdefghhjiikllmmmnmlmmkjjihhgggeeedccbcbaZaZYYYYXYYYYXXXXXXXYYYYaZZaaZaaaaaaabaaaaZZYYYXXYYXYYXYYXYYXXYXXYXYYXXYXXXXXXYYZYYZZYXWUTSRQPON&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.486641,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=24835|max=51034&chxp=1,1,49,100 http://3.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=%C3%90epeche+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:3,3,7,15,24,45,68,83,152,236,282,404,532,625,736,864,982,1026,1165,1246,1301,1288,1350,1325,1294,1277,1227,1185,1035,977,841,753,602,491,406,291,258,198,133,87,64,47,30,13,13,9,2,1,3,1&chds=0,1350&chbh=5&chxt=x&chxl=0:|min=22225|avg=24835|max=27868&chxp=0,1,46,100& http://9.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=%C3%90epeche+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:26.4,22.1,21.4,14.8,6.7,4.1,2.4,2.3&chds=0,100&chdls=ffffff&chco=C79C6E,FFE57F,FFE57F,FFE57F,FFE57F,FFE57F,FFE57F,ffffff&chl=crusader_strike 79.6s|final_verdict 66.4s|hammer_of_wrath 64.5s|judgment 44.5s|divine_storm 20.2s|exorcism 12.3s|execution_sentence 7.1s|waiting 6.9s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Ðepeche 24835
censure 721 2.9% 303.5 0.99sec 714 0 Periodic 99.4 1761 3672 2046 14.9% 22.1 528 1101 14.9% 99.1%

Stats details: censure

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 303.54 303.54 99.38 99.38 0.0000 3.0000 216868.60 216868.60 0.00 727.40 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 303.54 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.3 14.90% 1101.15 972 1449 1060.34 0 1449 3630 3630 0.00
multistrike 18.8 85.10% 528.16 486 725 528.59 486 629 9949 9949 0.00
hit 84.6 85.11% 1761.00 1620 2415 1762.29 1693 1822 148944 148944 0.00
crit 14.8 14.89% 3671.50 3240 4830 3677.33 3240 4512 54345 54345 0.00
 
DPS Timeline Chart
 

Action details: censure

Static Values
  • id:31803
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:31803
  • name:Censure
  • school:holy
  • tooltip:Holy damage every $t1 sec.
  • description:Deals $m1 additional Holy damage over {$31803d=15 seconds}. Stacks up to {$31803u=5} times.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.061776
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
crusader_strike 1691 6.8% 63.3 4.74sec 8034 6394 Direct 63.3 6524 13506 7531 14.4% 14.1 1957 4052 14.5%  

Stats details: crusader_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.33 63.33 0.00 0.00 1.2565 0.0000 508762.54 781887.70 34.93 6393.82 6393.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.04 14.46% 4052.16 3658 5233 3510.22 0 5233 8258 12691 30.22
multistrike 12.06 85.54% 1957.27 1829 2616 1958.64 1829 2616 23606 36278 34.93
hit 54.20 85.59% 6524.21 6097 8721 6528.31 6238 6822 353607 543438 34.93
crit 9.13 14.41% 13506.07 12195 17442 13527.43 0 17442 123292 189481 34.93
 
DPS Timeline Chart
 

Action details: crusader_strike

Static Values
  • id:35395
  • school:physical
  • resource:mana
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:640.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power<5
Spelldata
  • id:35395
  • name:Crusader Strike
  • school:physical
  • tooltip:
  • description:{$?s85673=true}|s85256[An instant strike that causes $sw2 Physical damage and grants 1 Holy Power.][An instant strike that causes $sw2 Physical damage.]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.20
 
divine_storm 1315 5.3% 16.1 17.49sec 24532 19509 Direct 16.1 19830 41219 23005 14.8% 3.6 5951 12365 14.9%  

Stats details: divine_storm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.10 16.10 0.00 0.00 1.2575 0.0000 394943.14 394943.14 0.00 19509.15 19509.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.53 14.90% 12365.01 10964 15681 5045.20 0 15681 6558 6558 0.00
multistrike 3.03 85.10% 5951.17 5482 7841 5597.42 0 7841 18033 18033 0.00
hit 13.71 85.16% 19830.04 18273 26136 19847.87 0 26136 271855 271855 0.00
crit 2.39 14.84% 41218.87 36546 52271 37328.33 0 52271 98497 98497 0.00
 
DPS Timeline Chart
 

Action details: divine_storm

Static Values
  • id:53385
  • school:holy
  • resource:holy_power
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.divine_crusader.react&holy_power=5&buff.final_verdict.up
Spelldata
  • id:53385
  • name:Divine Storm
  • school:holy
  • tooltip:
  • description:Deals $sw1 Holy damage to all enemies within $A1 yards. {$?s63220=false}[Using Divine Storm will also heal you for {$115515s1=4}% of your maximum health.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.78
 
execution_sentence 1237 5.0% 5.5 60.46sec 67642 51859 Periodic 53.7 5376 11868 6478 17.0% 11.9 1605 3538 16.9% 17.8%

Stats details: execution_sentence

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.48 5.48 53.67 53.67 1.3045 1.0000 370690.37 370690.37 0.00 6095.38 51859.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.48 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.0 16.93% 3537.81 1076 18918 3069.59 0 18918 7141 7141 0.00
multistrike 9.9 83.07% 1605.36 538 9459 1610.43 0 7902 15895 15895 0.00
hit 44.6 83.02% 5375.83 1794 31530 5382.28 3009 6929 239520 239520 0.00
crit 9.1 16.98% 11868.31 3587 63061 11919.65 0 63061 108134 108134 0.00
 
DPS Timeline Chart
 

Action details: execution_sentence

Static Values
  • id:114157
  • school:holy
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4096.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114157
  • name:Execution Sentence
  • school:holy
  • tooltip:
  • description:{$@spelldesc114916=A hammer slowly falls from the sky, causing ${$SPH*$114916m2/1000+26.72716306*$114916m1} Holy damage over {$114916d=10 seconds}. Damage increases over time, culminating in a final burst. Dispelling the effect triggers the final burst.} |CFFFFFFFFStay of Execution|R On a friendly target, the falling hammer heals for ${$SPH*$114917m2/1000+26.72716306*$114917m1} over {$114917d=10 seconds}. This healing is a large burst at first, and then decreases over time.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.342049
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
exorcism 340 1.4% 9.7 16.26sec 10631 8359 Direct 9.7 8844 17688 9965 12.7% 2.2 2653 5306 12.6%  

Stats details: exorcism

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.70 9.70 0.00 0.00 1.2718 0.0000 103132.96 103132.96 0.00 8358.97 8358.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.27 12.59% 5306.31 5306 5306 1273.30 0 5306 1444 1444 0.00
multistrike 1.89 87.41% 2653.15 2653 2653 2252.42 0 2653 5016 5016 0.00
hit 8.47 87.33% 8843.84 8844 8844 8843.84 8844 8844 74924 74924 0.00
crit 1.23 12.67% 17687.69 17688 17688 12704.01 0 17688 21748 21748 0.00
 
DPS Timeline Chart
 

Action details: exorcism

Static Values
  • id:879
  • school:holy
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1280.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.blazing_contempt.up&holy_power<=2&buff.holy_avenger.down
Spelldata
  • id:879
  • name:Exorcism
  • school:holy
  • tooltip:
  • description:Blasts the target with Holy Light, causing {$s1=1} Holy damage and generating 1 Holy Power. Your autoattacks have a {$87138h=20}% chance of resetting the cooldown of your Exorcism.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.686240
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
final_verdict 4473 18.0% 52.9 5.65sec 25382 20223 Direct 52.9 20475 42610 23795 15.0% 11.8 6141 12790 15.0%  

Stats details: final_verdict

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.94 52.94 0.00 0.00 1.2551 0.0000 1343614.10 1343614.10 0.00 20223.27 20223.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.76 14.99% 12790.00 11245 16083 10599.21 0 16083 22558 22558 0.00
multistrike 10.01 85.01% 6141.45 5622 8042 6145.65 0 8042 61450 61450 0.00
hit 45.00 85.00% 20474.82 18742 26806 20488.67 19428 21412 921275 921275 0.00
crit 7.94 15.00% 42609.63 37483 53611 42673.03 0 53611 338331 338331 0.00
 
DPS Timeline Chart
 

Action details: final_verdict

Static Values
  • id:157048
  • school:holy
  • resource:holy_power
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power=5|buff.holy_avenger.up&holy_power>=3
Spelldata
  • id:157048
  • name:Final Verdict
  • school:holy
  • tooltip:Damage and radius of your next Divine Storm increased by {$s3=100}%.
  • description:Empowers your weapon with holy energy, and performs a devastating strike, dealing $sw1 Holy damage. Also increases the damage and radius of your next Divine Storm by {$s3=100}%. Replaces Templar's Verdict.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.40
 
hammer_of_wrath 3710 14.9% 52.9 5.73sec 20952 17182 Direct 52.9 16474 34250 19644 17.8% 11.8 4941 10282 17.8%  

Stats details: hammer_of_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.90 52.89 0.00 0.00 1.2194 0.0000 1108454.04 1108454.04 0.00 17182.14 17182.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.10 17.82% 10282.07 7977 11893 9069.86 0 11893 21609 21609 0.00
multistrike 9.69 82.18% 4940.92 3989 5947 4942.87 0 5947 47883 47883 0.00
hit 43.46 82.17% 16474.14 13295 19822 16480.28 15598 17364 715946 715946 0.00
crit 9.43 17.83% 34250.03 26590 39644 34286.34 26590 39644 323017 323017 0.00
 
DPS Timeline Chart
 

Action details: hammer_of_wrath

Static Values
  • id:24275
  • school:holy
  • resource:mana
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:960.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:24275
  • name:Hammer of Wrath
  • school:holy
  • tooltip:
  • description:Hurls a magical hammer that strikes an enemy for {$s1=1} Holy damage{$?s53503=false}[ and generates a charge of Holy Power][]. Only usable on enemies that have 20% or less health{$?s53503=false}[ or during Avenging Wrath][].
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.028000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
hand_of_light 5974 24.0% 226.5 1.62sec 7911 0 Direct 226.5 7911 0 7911 0.0% 0.0 0 0 0.0%  

Stats details: hand_of_light

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 226.47 226.47 0.00 0.00 0.0000 0.0000 1791726.41 1791726.41 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 226.47 100.00% 7911.43 977 28624 7925.56 7008 9285 1791726 1791726 0.00
 
DPS Timeline Chart
 

Action details: hand_of_light

Static Values
  • id:96172
  • school:holy
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6746.97
  • base_dd_max:6746.97
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
judgment 1153 4.7% 34.6 7.72sec 10038 7814 Direct 34.6 8348 16707 9410 12.7% 7.7 2504 5013 12.7%  

Stats details: judgment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.63 34.63 0.00 0.00 1.2846 0.0000 347580.65 347580.65 0.00 7813.79 7813.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.97 12.66% 5013.01 5004 6004 3091.82 0 6004 4885 4885 0.00
multistrike 6.72 87.34% 2504.41 2502 3002 2500.79 0 3002 16834 16834 0.00
hit 30.23 87.29% 8348.02 8339 10007 8347.86 8339 8427 252343 252343 0.00
crit 4.40 12.71% 16707.30 16679 20015 16523.22 0 20015 73518 73518 0.00
 
DPS Timeline Chart
 

Action details: judgment

Static Values
  • id:20271
  • school:holy
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.empowered_seals.enabled&time<2
Spelldata
  • id:20271
  • name:Judgment
  • school:holy
  • tooltip:
  • description:Causes {$s1=1} Holy damage {$?s105424=false}[and generates 1 Holy Power]?s85256[and generates 1 Holy Power][]. Requires an active Seal to cast.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.696000
  • spell_power_mod.direct:0.576000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
melee 2444 9.9% 99.7 3.01sec 7363 2449 Direct 99.7 5936 12365 6902 15.0% 22.2 1781 3708 15.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.75 99.75 0.00 0.00 3.0063 0.0000 734410.72 1128673.32 34.93 2449.06 2449.06
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.34 15.03% 3708.49 3268 4688 3578.55 0 4688 12369 19009 33.66
multistrike 18.85 84.97% 1780.84 1634 2344 1782.24 1634 2107 33569 51590 34.93
hit 84.76 84.97% 5936.29 5447 7813 5940.55 5685 6152 503158 773275 34.93
crit 14.99 15.03% 12364.50 10894 15625 12382.99 10894 15625 185315 284800 34.93
 
DPS Timeline Chart
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
seal_of_truth_proc 1385 5.6% 303.5 0.99sec 1370 0 Direct 303.5 1102 2299 1285 15.2% 67.5 331 690 15.2%  

Stats details: seal_of_truth_proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 303.54 303.54 0.00 0.00 0.0000 0.0000 415924.37 415924.37 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 10.26 15.21% 689.96 603 864 690.53 0 864 7080 7080 0.00
multistrike 57.21 84.79% 330.75 301 432 331.00 308 366 18923 18923 0.00
hit 257.33 84.77% 1102.40 1005 1441 1103.25 1073 1136 283680 283680 0.00
crit 46.21 15.23% 2298.89 2009 2882 2301.42 2099 2561 106241 106241 0.00
 
DPS Timeline Chart
 

Action details: seal_of_truth_proc

Static Values
  • id:31801
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:31801
  • name:Seal of Truth
  • school:holy
  • tooltip:Melee attacks cause Holy damage over {$31803d=15 seconds}.
  • description:Fills you with Holy Light, causing melee attacks to deal $42463sw1 additional Holy damage and apply Censure to the target. Replaces Seal of Command. |CFFFFFFFFCensure|R {$@spelldesc31803=Deals $m1 additional Holy damage over {$31803d=15 seconds}. Stacks up to {$31803u=5} times.}
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.12
 
shattered_bleed 392 1.6% 17.7 17.37sec 6668 0 Direct 17.7 1653 3376 1910 14.9% 3.9 496 1011 14.8%  
Periodic 98.7 777 0 777 0.0% 21.9 236 0 0.0% 32.8%

Stats details: shattered_bleed

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.69 17.69 98.74 98.74 0.0000 1.0000 117939.77 117939.77 0.00 1194.46 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.58 14.77% 1011.26 944 1133 443.60 0 1133 586 586 0.00
multistrike 3.34 85.23% 496.25 472 566 476.90 0 566 1659 1659 0.00
hit 15.05 85.09% 1653.35 1573 1888 1653.14 1573 1825 24882 24882 0.00
crit 2.64 14.91% 3375.76 3147 3776 3143.94 0 3776 8904 8904 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike 21.9 100.00% 236.01 236 236 236.01 236 236 5178 5178 0.00
hit 98.7 100.00% 777.10 1 787 777.37 749 787 76731 76731 0.00
 
DPS Timeline Chart
 

Action details: shattered_bleed

Static Values
  • id:159238
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:159238
  • name:Shattered Bleed
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2.
  • description:Inflicts {$s1=1500} Bleed damage, plus an additional $o2 damage over {$d=6 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1499.91
  • base_dd_max:1499.91
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:749.87
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Ðepeche
avenging_wrath 3.0 121.09sec

Stats details: avenging_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 2.99 2.99 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.40 80.25% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.59 19.75% 0.00 0 0 0.00 0 0 0 0 0.00
 
HPS Timeline Chart
 

Action details: avenging_wrath

Static Values
  • id:31884
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:119.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ðepeche
  • harmful:false
  • if_expr:talent.seraphim.enabled
Spelldata
  • id:31884
  • name:Avenging Wrath
  • school:holy
  • tooltip:All damage and healing caused increased by {$s1=20}%.$?$w4>0[ Your falling speed is slowed.][]
  • description:Increases all damage and healing caused by {$s1=20}% for {$d=20 seconds}. {$?s54927=false}|s115931[ While Avenging Wrath is active, ][]{$?s54927=false}[you heal for {$115547s1=1}% of your maximum health every $115547t sec][]{$?s54927=false}&s115931[ and ][]{$?s115931=false}[your falling speed is slowed][]{$?s54927=false}|s115931[.][]
 
draenic_strength_potion 2.0 0.00sec

Stats details: draenic_strength_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156428
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156428
  • name:Draenic Strength Potion
  • school:physical
  • tooltip:Strength increased by {$s1=1000}.
  • description:Increases your strength by {$s1=1000} for {$d=25 seconds}.
 
rebuke 8.4 37.56sec

Stats details: rebuke

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.40 8.40 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.40 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: rebuke

Static Values
  • id:96231
  • school:physical
  • resource:mana
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:3744.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:96231
  • name:Rebuke
  • school:physical
  • tooltip:
  • description:Interrupts spellcasting and prevents any spell in that school from being cast for {$d=4 seconds}.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
avenging_wrath 3.0 0.0 121.1sec 121.1sec 28.23% 68.83% 0.0(0.0)

Buff details

  • buff initial source:Ðepeche
  • cooldown name:buff_avenging_wrath
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • avenging_wrath_1:28.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31884
  • name:Avenging Wrath
  • tooltip:All damage and healing caused increased by {$s1=20}%.$?$w4>0[ Your falling speed is slowed.][]
  • description:Increases all damage and healing caused by {$s1=20}% for {$d=20 seconds}. {$?s54927=false}|s115931[ While Avenging Wrath is active, ][]{$?s54927=false}[you heal for {$115547s1=1}% of your maximum health every $115547t sec][]{$?s54927=false}&s115931[ and ][]{$?s115931=false}[your falling speed is slowed][]{$?s54927=false}|s115931[.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 33.34% 0.0(0.0)

Buff details

  • buff initial source:Ðepeche
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_crusader 16.3 1.0 17.4sec 16.4sec 16.60% 100.00% 1.0(1.0)

Buff details

  • buff initial source:Ðepeche
  • cooldown name:buff_divine_crusader
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:25.00%
  • default_value:0.00

Stack Uptimes

  • divine_crusader_1:16.60%

Trigger Attempt Success

  • trigger_pct:24.77%

Spelldata details

  • id:144595
  • name:Divine Crusader
  • tooltip:Your next Divine Storm is free and deals {$s2=50}% more damage.
  • description:{$@spelldesc144593=Holy Power consumers have a 25% chance to make your next Divine Storm free and deal {$144595s2=50}% more damage.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
draenic_strength_potion 2.0 0.0 122.9sec 0.0sec 15.21% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Ðepeche
  • cooldown name:buff_draenic_strength_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:strength
  • amount:1000.00

Stack Uptimes

  • draenic_strength_potion_1:15.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156428
  • name:Draenic Strength Potion
  • tooltip:Strength increased by {$s1=1000}.
  • description:Increases your strength by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
final_verdict 16.8 47.9 17.6sec 4.6sec 75.10% 75.10% 47.9(47.9)

Buff details

  • buff initial source:Ðepeche
  • cooldown name:buff_final_verdict
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • final_verdict_1:75.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:157048
  • name:Final Verdict
  • tooltip:Damage and radius of your next Divine Storm increased by {$s3=100}%.
  • description:Empowers your weapon with holy energy, and performs a devastating strike, dealing $sw1 Holy damage. Also increases the damage and radius of your next Divine Storm by {$s3=100}%. Replaces Templar's Verdict.
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
glyph_double_jeopardy (glyph_double_jeopardy) 4.2 38.1 73.8sec 6.3sec 71.61% 71.62% 38.1(38.1)

Buff details

  • buff initial source:Ðepeche
  • cooldown name:buff_glyph_double_jeopardy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • glyph_double_jeopardy_1:71.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:54922
  • name:Glyph of Double Jeopardy
  • tooltip:
  • description:Judging a target increases the damage of your next Judgment by {$121027s1=20}%, but only if used on a different second target.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
selfless_healer 2.7 39.6 119.7sec 6.3sec 75.68% 75.68% 34.3(34.3)

Buff details

  • buff initial source:Ðepeche
  • cooldown name:buff_selfless_healer
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • selfless_healer_1:3.85%
  • selfless_healer_2:4.16%
  • selfless_healer_3:67.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114250
  • name:Selfless Healer
  • tooltip:Your next Flash of Light casts $w1% faster, costs $w3% less mana, and heals for $w2% greater effectiveness on others.
  • description:{$@spelldesc85804=Your successful Judgments reduce the cast time and mana cost of your next Flash of Light by {$114250s1=35}%, and increase its effect on others by $?c1[{$114250s4=35}][{$114250s2=20}]%. Stacks up to 3 times.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
spirit_of_the_warlords 3.0 0.0 120.6sec 120.6sec 19.04% 19.06% 0.0(0.0)

Buff details

  • buff initial source:Ðepeche
  • cooldown name:buff_spirit_of_the_warlords
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:crit_rating
  • amount:1396.00

Stack Uptimes

  • spirit_of_the_warlords_1:19.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162915
  • name:Spirit of the Warlords
  • tooltip:Critical strike increased by {$s1=1044}.
  • description:Critical strike increased by {$s1=1044} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_strength_flask

Buff details

  • buff initial source:Ðepeche
  • cooldown name:buff_greater_draenic_strength_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:strength
  • amount:250.00

Stack Uptimes

  • greater_draenic_strength_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156080
  • name:Greater Draenic Strength Flask
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
seal_of_truth

Buff details

  • buff initial source:Ðepeche
  • cooldown name:buff_seal_of_truth
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • seal_of_truth_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31801
  • name:Seal of Truth
  • tooltip:Melee attacks cause Holy damage over {$31803d=15 seconds}.
  • description:Fills you with Holy Light, causing melee attacks to deal $42463sw1 additional Holy damage and apply Censure to the target. Replaces Seal of Command. |CFFFFFFFFCensure|R {$@spelldesc31803=Deals $m1 additional Holy damage over {$31803d=15 seconds}. Stacks up to {$31803u=5} times.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Ðepeche
crusader_strike Mana 63.3 40529.9 640.0 640.0 12.6
execution_sentence Mana 5.5 22446.4 4096.0 4095.9 16.5
exorcism Mana 9.7 12417.9 1280.0 1280.0 8.3
final_verdict Holy Power 52.9 158.8 3.0 3.0 8460.7
hammer_of_wrath Mana 52.9 50787.4 960.0 960.0 21.8
rebuke Mana 8.4 31466.9 3744.0 3744.0 0.0
Resource Gains Type Count Total Average Overflow
external_healing Health 7.92 0.00 (0.00%) 0.00 74655.81 100.00%
sword_of_light Mana 149.66 156309.83 (100.00%) 1044.41 131042.62 45.60%
crusader_strike Holy Power 63.33 63.33 (39.45%) 1.00 0.00 0.00%
exorcism Holy Power 9.70 9.70 (6.04%) 1.00 0.00 0.00%
hammer_of_wrath Holy Power 52.89 52.89 (32.94%) 1.00 0.00 0.00%
judgment Holy Power 34.63 34.63 (21.57%) 1.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Mana 519.41 523.86
Holy Power 0.53 0.53
Combat End Resource Mean Min Max
Mana 30670.59 23200.00 32000.00
Holy Power 1.76 0.00 5.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 25.3%

Procs

Count Interval
divine_crusader 17.3 16.4sec
exorcism_cd_reset 19.9 14.5sec
wasted_exorcism_cd_reset 14.1 20.8sec

Statistics & Data Analysis

Fight Length
Sample Data Ðepeche Fight Length
Count 25000
Mean 300.94
Minimum 230.43
Maximum 374.11
Spread ( max - min ) 143.68
Range [ ( max - min ) / 2 * 100% ] 23.87%
DPS
Sample Data Ðepeche Damage Per Second
Count 25000
Mean 24835.48
Minimum 22225.50
Maximum 27868.05
Spread ( max - min ) 5642.55
Range [ ( max - min ) / 2 * 100% ] 11.36%
Standard Deviation 790.1650
5th Percentile 23561.87
95th Percentile 26145.65
( 95th Percentile - 5th Percentile ) 2583.78
Mean Distribution
Standard Deviation 4.9974
95.00% Confidence Intervall ( 24825.68 - 24845.27 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3888
0.1 Scale Factor Error with Delta=300 5329
0.05 Scale Factor Error with Delta=300 21319
0.01 Scale Factor Error with Delta=300 532990
Distribution Chart
DPS(e)
Sample Data Ðepeche Damage Per Second (Effective)
Count 25000
Mean 24835.48
Minimum 22225.50
Maximum 27868.05
Spread ( max - min ) 5642.55
Range [ ( max - min ) / 2 * 100% ] 11.36%
Damage
Sample Data Ðepeche Damage
Count 25000
Mean 7454047.67
Minimum 5558999.47
Maximum 9493425.45
Spread ( max - min ) 3934425.98
Range [ ( max - min ) / 2 * 100% ] 26.39%
DTPS
Sample Data Ðepeche Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Ðepeche Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Ðepeche Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Ðepeche Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Ðepeche Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Ðepeche Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data ÐepecheTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Ðepeche Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_strength_flask
1 0.00 food,type=sleeper_surprise
2 0.00 blessing_of_kings,if=!aura.str_agi_int.up
3 0.00 blessing_of_might,if=!aura.mastery.up
4 0.00 seal_of_truth,if=active_enemies<2
5 0.00 seal_of_righteousness,if=active_enemies>=2
6 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
7 0.00 potion,name=draenic_strength
Default action list Executed every time the actor is available.
# count action,conditions
8 8.40 rebuke
9 1.00 potion,name=draenic_strength,if=(buff.bloodlust.react|buff.avenging_wrath.up|target.time_to_die<=40)
A 1.00 auto_attack
B 0.00 speed_of_light,if=movement.distance>5
C 0.00 judgment,if=talent.empowered_seals.enabled&time<2
D 5.48 execution_sentence
E 0.00 lights_hammer
F 0.00 holy_avenger,sync=seraphim,if=talent.seraphim.enabled
G 0.00 holy_avenger,if=holy_power<=2&!talent.seraphim.enabled
H 0.00 avenging_wrath,sync=seraphim,if=talent.seraphim.enabled
I 2.99 avenging_wrath,if=!talent.seraphim.enabled
J 0.00 blood_fury
K 0.00 berserking
L 0.00 arcane_torrent
M 0.00 seraphim
N 0.00 wait,sec=cooldown.seraphim.remains,if=talent.seraphim.enabled&cooldown.seraphim.remains>0&cooldown.seraphim.remains<gcd.max&holy_power>=5
O 0.00 call_action_list,name=aoe,if=active_enemies>=5
P 0.00 call_action_list,name=cleave,if=active_enemies>=3
Q 0.00 call_action_list,name=single
actions.single
# count action,conditions
R 0.00 divine_storm,if=buff.divine_crusader.react&holy_power=5&buff.final_verdict.up
S 0.00 divine_storm,if=buff.divine_crusader.react&holy_power=5&active_enemies=2&!talent.final_verdict.enabled
T 0.00 divine_storm,if=holy_power=5&active_enemies=2&buff.final_verdict.up
U 0.00 divine_storm,if=buff.divine_crusader.react&holy_power=5&(talent.seraphim.enabled&cooldown.seraphim.remains<=4)
V 0.00 templars_verdict,if=holy_power=5|buff.holy_avenger.up&holy_power>=3&(!talent.seraphim.enabled|cooldown.seraphim.remains>5)
W 0.00 templars_verdict,if=buff.divine_purpose.react&buff.divine_purpose.remains<3
X 0.00 divine_storm,if=buff.divine_crusader.react&buff.divine_crusader.remains<3&!talent.final_verdict.enabled
Y 1.23 final_verdict,if=holy_power=5|buff.holy_avenger.up&holy_power>=3
Z 0.00 final_verdict,if=buff.divine_purpose.react&buff.divine_purpose.remains<4
a 52.90 hammer_of_wrath
b 0.00 judgment,if=talent.empowered_seals.enabled&seal.truth&buff.maraads_truth.remains<cooldown.judgment.duration
c 0.00 judgment,if=talent.empowered_seals.enabled&seal.righteousness&buff.liadrins_righteousness.remains<cooldown.judgment.duration
d 0.00 exorcism,if=buff.blazing_contempt.up&holy_power<=2&buff.holy_avenger.down
e 0.00 seal_of_truth,if=talent.empowered_seals.enabled&buff.maraads_truth.down
f 0.00 seal_of_righteousness,if=talent.empowered_seals.enabled&buff.liadrins_righteousness.down&!buff.avenging_wrath.up&!buff.bloodlust.up
g 9.24 divine_storm,if=buff.divine_crusader.react&buff.final_verdict.up&(buff.avenging_wrath.up|target.health.pct<35)
h 30.90 final_verdict,if=buff.avenging_wrath.up|target.health.pct<35
i 0.00 templars_verdict,if=buff.avenging_wrath.up|target.health.pct<35&(!talent.seraphim.enabled|cooldown.seraphim.remains>6)
j 63.33 crusader_strike,if=holy_power<5
k 0.00 divine_storm,if=buff.divine_crusader.react&(buff.avenging_wrath.up|target.health.pct<35)&!talent.final_verdict.enabled
l 6.86 divine_storm,if=buff.divine_crusader.react&buff.final_verdict.up
m 0.00 final_verdict,if=buff.divine_purpose.react
n 9.13 final_verdict,if=holy_power>=4
o 1.00 judgment,cycle_targets=1,if=last_judgment_target!=target&glyph.double_jeopardy.enabled&holy_power<5&cooldown.seraphim.remains<=3
p 0.00 exorcism,if=glyph.mass_exorcism.enabled&active_enemies>=2&holy_power<5
q 33.63 judgment,,if=holy_power<5
r 11.67 final_verdict,if=holy_power>=3
s 0.00 exorcism,if=talent.seraphim.enabled&cooldown.seraphim.remains<=15
t 0.00 templars_verdict,if=buff.divine_purpose.react
u 0.00 divine_storm,if=buff.divine_crusader.react&!talent.final_verdict.enabled
v 0.00 templars_verdict,if=holy_power>=4&(!talent.seraphim.enabled|cooldown.seraphim.remains>7)
w 0.00 seal_of_truth,if=talent.empowered_seals.enabled&buff.maraads_truth.remains<cooldown.judgment.duration
x 0.00 seal_of_righteousness,if=talent.empowered_seals.enabled&buff.liadrins_righteousness.remains<cooldown.judgment.duration&!buff.bloodlust.up
y 9.70 exorcism,if=holy_power<5
z 0.00 templars_verdict,if=holy_power>=3&(!talent.seraphim.enabled|cooldown.seraphim.remains>9)
{ 0.00 holy_prism

Sample Sequence

0147ADIaja8hajahajahajahajahagajahagahjlojryjqrj8qjryjqrjyqjnjDqjnyjqnjqjny8jqnjyqjYyjnqjryjqrjqjryjqrj8lqjrlDI9ajahagajahajahajahajahaj8qnjyqjYjqnjyqjYjqnjyDjnqjra8jqhajqhagjqahjqahjqahjqahjqa8hgjahgjaqhgDIajahajahagajahaja8hajahajahjqahgjahjqahjq

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/5: 100% holy_power
Pre food Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/5: 100% holy_power
Pre seal_of_truth Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/5: 100% holy_power
Pre potion Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/5: 100% holy_power draenic_strength_potion
0:00.000 auto_attack Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power draenic_strength_potion
0:00.000 execution_sentence Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power draenic_strength_potion
0:01.305 avenging_wrath Ðepeche 27904.0/32000: 87% mana | 0.0/5: 0% holy_power bloodlust, draenic_strength_potion
0:01.305 hammer_of_wrath Fluffy_Pillow 27904.0/32000: 87% mana | 0.0/5: 0% holy_power bloodlust, avenging_wrath, draenic_strength_potion
0:02.312 crusader_strike Fluffy_Pillow 28864.0/32000: 90% mana | 1.0/5: 20% holy_power bloodlust, avenging_wrath, draenic_strength_potion
0:03.317 hammer_of_wrath Fluffy_Pillow 28224.0/32000: 88% mana | 2.0/5: 40% holy_power bloodlust, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:04.321 rebuke Fluffy_Pillow 29184.0/32000: 91% mana | 3.0/5: 60% holy_power bloodlust, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:04.321 final_verdict Fluffy_Pillow 25440.0/32000: 80% mana | 3.0/5: 60% holy_power bloodlust, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:05.324 hammer_of_wrath Fluffy_Pillow 25440.0/32000: 80% mana | 0.0/5: 0% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:06.327 crusader_strike Fluffy_Pillow 26400.0/32000: 83% mana | 1.0/5: 20% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:07.331 hammer_of_wrath Fluffy_Pillow 25760.0/32000: 81% mana | 2.0/5: 40% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:08.337 final_verdict Fluffy_Pillow 26720.0/32000: 84% mana | 3.0/5: 60% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:09.341 hammer_of_wrath Fluffy_Pillow 26720.0/32000: 84% mana | 0.0/5: 0% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:10.345 crusader_strike Fluffy_Pillow 27680.0/32000: 87% mana | 1.0/5: 20% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:11.349 hammer_of_wrath Fluffy_Pillow 27040.0/32000: 85% mana | 2.0/5: 40% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:12.355 final_verdict Fluffy_Pillow 28000.0/32000: 88% mana | 3.0/5: 60% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:13.360 hammer_of_wrath Fluffy_Pillow 28000.0/32000: 88% mana | 0.0/5: 0% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:14.364 crusader_strike Fluffy_Pillow 28960.0/32000: 91% mana | 1.0/5: 20% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:15.368 hammer_of_wrath Fluffy_Pillow 28320.0/32000: 89% mana | 2.0/5: 40% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:16.371 final_verdict Fluffy_Pillow 29280.0/32000: 92% mana | 3.0/5: 60% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:17.376 hammer_of_wrath Fluffy_Pillow 29280.0/32000: 92% mana | 0.0/5: 0% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:18.379 crusader_strike Fluffy_Pillow 30240.0/32000: 95% mana | 1.0/5: 20% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:19.382 hammer_of_wrath Fluffy_Pillow 29600.0/32000: 93% mana | 2.0/5: 40% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:20.388 final_verdict Fluffy_Pillow 30560.0/32000: 96% mana | 3.0/5: 60% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords
0:21.394 hammer_of_wrath Fluffy_Pillow 30560.0/32000: 96% mana | 0.0/5: 0% holy_power bloodlust, final_verdict, avenging_wrath, divine_crusader, spirit_of_the_warlords
0:22.399 divine_storm Fluffy_Pillow 31520.0/32000: 99% mana | 1.0/5: 20% holy_power bloodlust, final_verdict, avenging_wrath, divine_crusader, spirit_of_the_warlords
0:23.403 hammer_of_wrath Fluffy_Pillow 31520.0/32000: 99% mana | 1.0/5: 20% holy_power bloodlust, avenging_wrath, divine_crusader
0:24.409 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bloodlust, avenging_wrath, divine_crusader
0:25.415 hammer_of_wrath Fluffy_Pillow 31360.0/32000: 98% mana | 3.0/5: 60% holy_power bloodlust, avenging_wrath, divine_crusader
0:26.421 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power bloodlust, avenging_wrath, divine_crusader
0:27.427 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, final_verdict, avenging_wrath, divine_crusader
0:28.431 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bloodlust, final_verdict, avenging_wrath, divine_crusader
0:29.434 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bloodlust, avenging_wrath
0:30.439 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bloodlust, avenging_wrath
0:31.444 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power bloodlust, final_verdict, divine_crusader
0:32.448 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, final_verdict, divine_crusader
0:33.452 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust
0:34.458 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bloodlust, glyph_double_jeopardy, selfless_healer(2)
0:35.463 final_verdict Fluffy_Pillow 31360.0/32000: 98% mana | 3.0/5: 60% holy_power bloodlust, glyph_double_jeopardy, selfless_healer(2)
0:36.467 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer(2)
0:37.473 crusader_strike Fluffy_Pillow 30720.0/32000: 96% mana | 1.0/5: 20% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer(2)
0:38.478 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer(2)
0:39.483 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:40.488 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:41.493 rebuke Fluffy_Pillow 31360.0/32000: 98% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:41.493 Waiting 1.000 sec 27616.0/32000: 86% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:42.493 judgment Fluffy_Pillow 29536.0/32000: 92% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:43.797 crusader_strike Fluffy_Pillow 29536.0/32000: 92% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:45.100 final_verdict Fluffy_Pillow 30816.0/32000: 96% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:46.405 Waiting 0.100 sec 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:46.505 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:47.809 crusader_strike Fluffy_Pillow 30720.0/32000: 96% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:49.113 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:50.417 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:51.721 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:53.025 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:54.330 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:55.635 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:56.941 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:58.245 Waiting 1.300 sec 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:59.545 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:00.848 execution_sentence Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:02.153 judgment Fluffy_Pillow 29824.0/32000: 93% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:03.457 crusader_strike Fluffy_Pillow 29824.0/32000: 93% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:04.763 final_verdict Fluffy_Pillow 31104.0/32000: 97% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:06.067 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:07.372 crusader_strike Fluffy_Pillow 30720.0/32000: 96% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:08.677 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:09.981 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:11.284 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:12.589 Waiting 1.300 sec 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:13.889 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:15.195 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:16.501 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:17.805 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:19.112 rebuke Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:19.112 crusader_strike Fluffy_Pillow 28256.0/32000: 88% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:20.415 judgment Fluffy_Pillow 29536.0/32000: 92% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:21.718 final_verdict Fluffy_Pillow 29536.0/32000: 92% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:23.021 crusader_strike Fluffy_Pillow 31456.0/32000: 98% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:24.326 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:25.630 judgment Fluffy_Pillow 30720.0/32000: 96% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:26.935 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:28.239 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/5: 100% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:29.543 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:30.848 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:32.153 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:33.456 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:34.761 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:36.065 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:37.369 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:38.674 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:39.977 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:41.280 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:42.584 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:43.889 Waiting 1.300 sec 31360.0/32000: 98% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:45.189 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:46.494 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:47.799 final_verdict Fluffy_Pillow 31360.0/32000: 98% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:49.103 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:50.409 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:51.713 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:53.019 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:54.323 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader
1:55.628 rebuke Fluffy_Pillow 31360.0/32000: 98% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader
1:55.628 divine_storm Fluffy_Pillow 27616.0/32000: 86% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader
1:56.932 judgment Fluffy_Pillow 29536.0/32000: 92% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, selfless_healer(3)
1:58.237 crusader_strike Fluffy_Pillow 31456.0/32000: 98% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, selfless_healer(3)
1:59.542 final_verdict Fluffy_Pillow 30816.0/32000: 96% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, selfless_healer(3)
2:00.846 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader
2:02.151 execution_sentence Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, selfless_healer(3), divine_crusader, spirit_of_the_warlords
2:03.457 avenging_wrath Ðepeche 27904.0/32000: 87% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, selfless_healer(3), divine_crusader, spirit_of_the_warlords
2:03.457 potion Fluffy_Pillow 27904.0/32000: 87% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, selfless_healer(3), avenging_wrath, divine_crusader, spirit_of_the_warlords
2:03.457 hammer_of_wrath Fluffy_Pillow 27904.0/32000: 87% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, selfless_healer(3), avenging_wrath, divine_crusader, spirit_of_the_warlords, draenic_strength_potion
2:04.761 crusader_strike Fluffy_Pillow 28864.0/32000: 90% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, selfless_healer(3), avenging_wrath, divine_crusader, spirit_of_the_warlords, draenic_strength_potion
2:06.064 hammer_of_wrath Fluffy_Pillow 30144.0/32000: 94% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, selfless_healer(3), avenging_wrath, divine_crusader, spirit_of_the_warlords, draenic_strength_potion
2:07.368 final_verdict Fluffy_Pillow 29184.0/32000: 91% mana | 3.0/5: 60% holy_power selfless_healer(3), avenging_wrath, divine_crusader, spirit_of_the_warlords, draenic_strength_potion
2:08.670 hammer_of_wrath Fluffy_Pillow 31104.0/32000: 97% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3), avenging_wrath, divine_crusader, spirit_of_the_warlords, draenic_strength_potion
2:09.972 divine_storm Fluffy_Pillow 30144.0/32000: 94% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), avenging_wrath, divine_crusader, spirit_of_the_warlords, draenic_strength_potion
2:11.275 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power selfless_healer(3), avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
2:12.578 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
2:13.883 hammer_of_wrath Fluffy_Pillow 31360.0/32000: 98% mana | 3.0/5: 60% holy_power avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
2:15.186 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
2:16.491 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
2:17.794 crusader_strike Fluffy_Pillow 31040.0/32000: 97% mana | 2.0/5: 40% holy_power final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
2:19.097 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
2:20.402 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
2:21.708 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, avenging_wrath, draenic_strength_potion
2:23.013 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, avenging_wrath, draenic_strength_potion
2:24.318 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, avenging_wrath, draenic_strength_potion
2:25.623 final_verdict Fluffy_Pillow 31040.0/32000: 97% mana | 4.0/5: 80% holy_power final_verdict, avenging_wrath, draenic_strength_potion
2:26.928 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, avenging_wrath, draenic_strength_potion
2:28.232 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, avenging_wrath, draenic_strength_potion
2:29.538 hammer_of_wrath Fluffy_Pillow 31360.0/32000: 98% mana | 3.0/5: 60% holy_power final_verdict, avenging_wrath
2:30.843 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power final_verdict, avenging_wrath
2:32.149 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, avenging_wrath
2:33.453 crusader_strike Fluffy_Pillow 31040.0/32000: 97% mana | 2.0/5: 40% holy_power final_verdict, avenging_wrath
2:34.757 rebuke Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict
2:34.757 judgment Fluffy_Pillow 28256.0/32000: 88% mana | 3.0/5: 60% holy_power final_verdict
2:36.062 final_verdict Fluffy_Pillow 30176.0/32000: 94% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, final_verdict, selfless_healer
2:37.367 crusader_strike Fluffy_Pillow 30176.0/32000: 94% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer
2:38.673 exorcism Fluffy_Pillow 31456.0/32000: 98% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer
2:39.977 judgment Fluffy_Pillow 30176.0/32000: 94% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer
2:41.284 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(2)
2:42.589 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/5: 100% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(2)
2:43.895 Waiting 1.300 sec 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(2)
2:45.195 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(2)
2:46.499 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(2)
2:47.804 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:49.108 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:50.413 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:51.718 judgment Fluffy_Pillow 30720.0/32000: 96% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:53.023 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:54.327 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/5: 100% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:55.631 Waiting 1.300 sec 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:56.931 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:58.236 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:59.541 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:00.845 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:02.149 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:03.452 execution_sentence Fluffy_Pillow 30720.0/32000: 96% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:04.754 crusader_strike Fluffy_Pillow 28544.0/32000: 89% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:06.057 final_verdict Fluffy_Pillow 29824.0/32000: 93% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:07.363 judgment Fluffy_Pillow 29824.0/32000: 93% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:08.667 crusader_strike Fluffy_Pillow 31744.0/32000: 99% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:09.973 final_verdict Fluffy_Pillow 31104.0/32000: 97% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:11.277 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:12.581 rebuke Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:12.581 crusader_strike Fluffy_Pillow 28256.0/32000: 88% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:13.885 judgment Fluffy_Pillow 27616.0/32000: 86% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:15.190 final_verdict Fluffy_Pillow 29536.0/32000: 92% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:16.495 hammer_of_wrath Fluffy_Pillow 31456.0/32000: 98% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:17.797 crusader_strike Fluffy_Pillow 30496.0/32000: 95% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:19.102 judgment Fluffy_Pillow 31776.0/32000: 99% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:20.407 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:21.712 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader
3:23.018 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader
3:24.323 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, selfless_healer(3)
3:25.626 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, selfless_healer(3)
3:26.930 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, selfless_healer(3)
3:28.235 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, selfless_healer(3)
3:29.539 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:30.844 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:32.149 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:33.455 final_verdict Fluffy_Pillow 31040.0/32000: 97% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:34.760 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:36.064 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:37.370 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:38.673 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:39.978 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:41.283 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:42.586 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:43.890 final_verdict Fluffy_Pillow 31040.0/32000: 97% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:45.195 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:46.498 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:47.801 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:49.108 rebuke Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:49.108 final_verdict Fluffy_Pillow 28256.0/32000: 88% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:50.413 divine_storm Fluffy_Pillow 30176.0/32000: 94% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader
3:51.718 crusader_strike Fluffy_Pillow 30176.0/32000: 94% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, selfless_healer(3)
3:53.022 hammer_of_wrath Fluffy_Pillow 31456.0/32000: 98% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, selfless_healer(3)
3:54.327 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, selfless_healer(3)
3:55.631 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader
3:56.936 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power selfless_healer(3)
3:58.240 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power selfless_healer(3)
3:59.545 judgment Fluffy_Pillow 31040.0/32000: 97% mana | 2.0/5: 40% holy_power selfless_healer(3)
4:00.850 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, selfless_healer(3)
4:02.155 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader
4:03.460 execution_sentence Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, selfless_healer(3)
4:04.763 avenging_wrath Ðepeche 29824.0/32000: 93% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, selfless_healer(3)
4:04.763 hammer_of_wrath Fluffy_Pillow 29824.0/32000: 93% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, selfless_healer(3), avenging_wrath
4:06.068 crusader_strike Fluffy_Pillow 30784.0/32000: 96% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, selfless_healer(3), avenging_wrath
4:07.375 hammer_of_wrath Fluffy_Pillow 30144.0/32000: 94% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, selfless_healer(3), avenging_wrath
4:08.678 final_verdict Fluffy_Pillow 31104.0/32000: 97% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, selfless_healer(3), avenging_wrath
4:09.982 hammer_of_wrath Fluffy_Pillow 31104.0/32000: 97% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3), avenging_wrath
4:11.288 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), avenging_wrath
4:12.591 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3), avenging_wrath
4:13.898 final_verdict Fluffy_Pillow 31040.0/32000: 97% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3), avenging_wrath
4:15.203 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, avenging_wrath, divine_crusader
4:16.508 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, avenging_wrath, divine_crusader, spirit_of_the_warlords
4:17.811 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power avenging_wrath, spirit_of_the_warlords
4:19.114 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power avenging_wrath, spirit_of_the_warlords
4:20.419 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power avenging_wrath, spirit_of_the_warlords
4:21.724 final_verdict Fluffy_Pillow 31040.0/32000: 97% mana | 4.0/5: 80% holy_power avenging_wrath, spirit_of_the_warlords
4:23.027 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, avenging_wrath, spirit_of_the_warlords
4:24.329 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, avenging_wrath, spirit_of_the_warlords
4:25.633 hammer_of_wrath Fluffy_Pillow 31360.0/32000: 98% mana | 3.0/5: 60% holy_power final_verdict, avenging_wrath, spirit_of_the_warlords
4:26.937 rebuke Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power final_verdict, avenging_wrath, spirit_of_the_warlords
4:26.937 final_verdict Fluffy_Pillow 28256.0/32000: 88% mana | 4.0/5: 80% holy_power final_verdict, avenging_wrath, spirit_of_the_warlords
4:28.242 hammer_of_wrath Fluffy_Pillow 30176.0/32000: 94% mana | 1.0/5: 20% holy_power final_verdict, avenging_wrath, spirit_of_the_warlords
4:29.546 crusader_strike Fluffy_Pillow 29216.0/32000: 91% mana | 2.0/5: 40% holy_power final_verdict, avenging_wrath, spirit_of_the_warlords
4:30.851 hammer_of_wrath Fluffy_Pillow 30496.0/32000: 95% mana | 3.0/5: 60% holy_power final_verdict, avenging_wrath, spirit_of_the_warlords
4:32.155 final_verdict Fluffy_Pillow 31456.0/32000: 98% mana | 4.0/5: 80% holy_power final_verdict, avenging_wrath, spirit_of_the_warlords
4:33.461 hammer_of_wrath Fluffy_Pillow 31456.0/32000: 98% mana | 1.0/5: 20% holy_power final_verdict, avenging_wrath, spirit_of_the_warlords
4:34.765 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, spirit_of_the_warlords
4:36.069 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, spirit_of_the_warlords
4:37.374 final_verdict Fluffy_Pillow 31040.0/32000: 97% mana | 4.0/5: 80% holy_power final_verdict
4:38.679 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict
4:39.983 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power final_verdict
4:41.288 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer
4:42.592 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, final_verdict, selfless_healer
4:43.895 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer, divine_crusader
4:45.201 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, selfless_healer
4:46.506 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, selfless_healer
4:47.810 final_verdict Fluffy_Pillow 31040.0/32000: 97% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, selfless_healer
4:49.114 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer
4:50.420 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer
4:51.723 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
4:53.028 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
4:54.331 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
4:55.634 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4545 4065 3945 (1537)
Agility 477 455 455
Stamina 4427 4025 4025
Intellect 1094 1042 1042
Spirit 782 782 782
Health 265620 241500 0
Mana 32000 32000 0
Holy Power 5 5 0
Spell Power 5000 4065 0
Crit 15.47% 10.47% 602
Haste 15.30% 9.81% 981
Multistrike 11.12% 6.12% 404
Damage / Heal Versatility 4.89% 1.89% 246
Attack Power 5000 4065 0
Mastery 53.39% 39.44% 1048
Armor 1983 1983 1983

Talents

Level
15 Speed of Light Long Arm of the Law Pursuit of Justice
30 Fist of Justice Repentance Blinding Light
45 Selfless Healer Eternal Flame Sacred Shield
60 Hand of Purity Unbreakable Spirit Clemency
75 Holy Avenger Sanctified Wrath Divine Purpose
90 Holy Prism Light's Hammer Execution Sentence
100 Empowered Seals Seraphim Final Verdict (Retribution Paladin)

Profile

paladin="Ðepeche"
origin="http://eu.battle.net/wow/en/character/forscherliga/Ðepeche/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/95/55886431-avatar.jpg"
level=100
race=human
role=attack
position=back
professions=jewelcrafting=700/blacksmithing=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#bb!2001122
glyphs=hand_of_sacrifice/double_jeopardy/templars_verdict/seal_of_blood/winged_vengeance/righteous_retreat
spec=retribution

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_strength_flask
actions.precombat+=/food,type=sleeper_surprise
actions.precombat+=/blessing_of_kings,if=!aura.str_agi_int.up
actions.precombat+=/blessing_of_might,if=!aura.mastery.up
actions.precombat+=/seal_of_truth,if=active_enemies<2
actions.precombat+=/seal_of_righteousness,if=active_enemies>=2
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=draenic_strength

# Executed every time the actor is available.

actions=rebuke
actions+=/potion,name=draenic_strength,if=(buff.bloodlust.react|buff.avenging_wrath.up|target.time_to_die<=40)
actions+=/auto_attack
actions+=/speed_of_light,if=movement.distance>5
actions+=/judgment,if=talent.empowered_seals.enabled&time<2
actions+=/execution_sentence
actions+=/lights_hammer
actions+=/holy_avenger,sync=seraphim,if=talent.seraphim.enabled
actions+=/holy_avenger,if=holy_power<=2&!talent.seraphim.enabled
actions+=/avenging_wrath,sync=seraphim,if=talent.seraphim.enabled
actions+=/avenging_wrath,if=!talent.seraphim.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/seraphim
actions+=/wait,sec=cooldown.seraphim.remains,if=talent.seraphim.enabled&cooldown.seraphim.remains>0&cooldown.seraphim.remains<gcd.max&holy_power>=5
actions+=/call_action_list,name=aoe,if=active_enemies>=5
actions+=/call_action_list,name=cleave,if=active_enemies>=3
actions+=/call_action_list,name=single

actions.single=divine_storm,if=buff.divine_crusader.react&holy_power=5&buff.final_verdict.up
actions.single+=/divine_storm,if=buff.divine_crusader.react&holy_power=5&active_enemies=2&!talent.final_verdict.enabled
actions.single+=/divine_storm,if=holy_power=5&active_enemies=2&buff.final_verdict.up
actions.single+=/divine_storm,if=buff.divine_crusader.react&holy_power=5&(talent.seraphim.enabled&cooldown.seraphim.remains<=4)
actions.single+=/templars_verdict,if=holy_power=5|buff.holy_avenger.up&holy_power>=3&(!talent.seraphim.enabled|cooldown.seraphim.remains>5)
actions.single+=/templars_verdict,if=buff.divine_purpose.react&buff.divine_purpose.remains<3
actions.single+=/divine_storm,if=buff.divine_crusader.react&buff.divine_crusader.remains<3&!talent.final_verdict.enabled
actions.single+=/final_verdict,if=holy_power=5|buff.holy_avenger.up&holy_power>=3
actions.single+=/final_verdict,if=buff.divine_purpose.react&buff.divine_purpose.remains<4
actions.single+=/hammer_of_wrath
actions.single+=/judgment,if=talent.empowered_seals.enabled&seal.truth&buff.maraads_truth.remains<cooldown.judgment.duration
actions.single+=/judgment,if=talent.empowered_seals.enabled&seal.righteousness&buff.liadrins_righteousness.remains<cooldown.judgment.duration
actions.single+=/exorcism,if=buff.blazing_contempt.up&holy_power<=2&buff.holy_avenger.down
actions.single+=/seal_of_truth,if=talent.empowered_seals.enabled&buff.maraads_truth.down
actions.single+=/seal_of_righteousness,if=talent.empowered_seals.enabled&buff.liadrins_righteousness.down&!buff.avenging_wrath.up&!buff.bloodlust.up
actions.single+=/divine_storm,if=buff.divine_crusader.react&buff.final_verdict.up&(buff.avenging_wrath.up|target.health.pct<35)
actions.single+=/final_verdict,if=buff.avenging_wrath.up|target.health.pct<35
actions.single+=/templars_verdict,if=buff.avenging_wrath.up|target.health.pct<35&(!talent.seraphim.enabled|cooldown.seraphim.remains>6)
actions.single+=/crusader_strike,if=holy_power<5
actions.single+=/divine_storm,if=buff.divine_crusader.react&(buff.avenging_wrath.up|target.health.pct<35)&!talent.final_verdict.enabled
actions.single+=/divine_storm,if=buff.divine_crusader.react&buff.final_verdict.up
actions.single+=/final_verdict,if=buff.divine_purpose.react
actions.single+=/final_verdict,if=holy_power>=4
actions.single+=/judgment,cycle_targets=1,if=last_judgment_target!=target&glyph.double_jeopardy.enabled&holy_power<5&cooldown.seraphim.remains<=3
actions.single+=/exorcism,if=glyph.mass_exorcism.enabled&active_enemies>=2&holy_power<5
actions.single+=/judgment,,if=holy_power<5
actions.single+=/final_verdict,if=holy_power>=3
actions.single+=/exorcism,if=talent.seraphim.enabled&cooldown.seraphim.remains<=15
actions.single+=/templars_verdict,if=buff.divine_purpose.react
actions.single+=/divine_storm,if=buff.divine_crusader.react&!talent.final_verdict.enabled
actions.single+=/templars_verdict,if=holy_power>=4&(!talent.seraphim.enabled|cooldown.seraphim.remains>7)
actions.single+=/seal_of_truth,if=talent.empowered_seals.enabled&buff.maraads_truth.remains<cooldown.judgment.duration
actions.single+=/seal_of_righteousness,if=talent.empowered_seals.enabled&buff.liadrins_righteousness.remains<cooldown.judgment.duration&!buff.bloodlust.up
actions.single+=/exorcism,if=holy_power<5
actions.single+=/templars_verdict,if=holy_power>=3&(!talent.seraphim.enabled|cooldown.seraphim.remains>9)
actions.single+=/holy_prism

actions.cleave=final_verdict,if=buff.final_verdict.down&holy_power=5
actions.cleave+=/divine_storm,if=buff.divine_crusader.react&holy_power=5&buff.final_verdict.up
actions.cleave+=/divine_storm,if=holy_power=5&buff.final_verdict.up
actions.cleave+=/divine_storm,if=holy_power=5&(!talent.seraphim.enabled|cooldown.seraphim.remains>4)&!talent.final_verdict.enabled
actions.cleave+=/exorcism,if=buff.blazing_contempt.up&holy_power<=2&buff.holy_avenger.down
actions.cleave+=/hammer_of_wrath
actions.cleave+=/judgment,if=talent.empowered_seals.enabled&seal.righteousness&buff.liadrins_righteousness.remains<=5
actions.cleave+=/divine_storm,if=holy_power>=4&(!talent.seraphim.enabled|cooldown.seraphim.remains>6)&!talent.final_verdict.enabled
actions.cleave+=/crusader_strike
actions.cleave+=/divine_storm,if=holy_power>=3&(!talent.seraphim.enabled|cooldown.seraphim.remains>7)&!talent.final_verdict.enabled
actions.cleave+=/final_verdict,if=buff.final_verdict.down
actions.cleave+=/divine_storm,if=buff.final_verdict.up
actions.cleave+=/exorcism,if=glyph.mass_exorcism.enabled
actions.cleave+=/judgment,cycle_targets=1,if=glyph.double_jeopardy.enabled
actions.cleave+=/judgment
actions.cleave+=/exorcism

actions.aoe=divine_storm,if=holy_power=5&(!talent.seraphim.enabled|cooldown.seraphim.remains>4)
actions.aoe+=/exorcism,if=buff.blazing_contempt.up&holy_power<=2&buff.holy_avenger.down
actions.aoe+=/hammer_of_wrath
actions.aoe+=/hammer_of_the_righteous
actions.aoe+=/judgment,if=talent.empowered_seals.enabled&seal.righteousness&buff.liadrins_righteousness.remains<=5
actions.aoe+=/divine_storm,if=(!talent.seraphim.enabled|cooldown.seraphim.remains>6)
actions.aoe+=/exorcism,if=glyph.mass_exorcism.enabled
actions.aoe+=/holy_prism,target=self
actions.aoe+=/judgment,cycle_targets=1,if=glyph.double_jeopardy.enabled
actions.aoe+=/judgment
actions.aoe+=/exorcism

head=casque_of_the_iron_bomber,id=113600,bonus_id=566
neck=spirewalkers_chain,id=114540,bonus_id=134,enchant=40mastery
shoulders=primal_gladiators_scaled_shoulders,id=115700
back=cloak_of_ruminant_deception,id=113830,bonus_id=566,enchant=gift_of_mastery
chest=rivetsealed_breastplate,id=109896,bonus_id=524
shirt=wraps_of_the_bloodsoaked_brawler,id=98543
wrists=bouldercrush_vambraces,id=118954,bonus_id=78
hands=exceptional_crystalplated_gauntlets,id=115390
waist=fleshchewer_greatbelt,id=113659
legs=legplates_of_fractured_crystal,id=113648,bonus_id=566
feet=crazed_bombers_greaves,id=114504,bonus_id=487
finger1=grunts_solid_signet,id=113599,bonus_id=566,enchant=50mastery
finger2=timeless_solium_band_of_brutality,id=118295,enchant=50mastery
trinket1=skull_of_war,id=112318,bonus_id=525/530
trinket2=mote_of_corruption,id=110010,bonus_id=524
main_hand=blood_gutter_greatsword,id=115418,enchant=mark_of_the_shattered_hand

# Gear Summary
# gear_strength=2418
# gear_stamina=3135
# gear_crit_rating=602
# gear_haste_rating=981
# gear_mastery_rating=998
# gear_armor=1983
# gear_multistrike_rating=404
# gear_versatility_rating=146

Swæty

Swæty : 23106 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
23106.4 23106.4 7.3 / 0.031% 2295.0 / 9.9% 57.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
394.0 394.0 Mana 0.00% 40.1 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Swæty/advanced
Talents
  • 15: Angelic Bulwark
  • 30: Body and Soul
  • 45: Insanity (Shadow Priest)
  • 60: Dominate Mind
  • 75: Twist of Fate
  • 90: Halo (Shadow Priest)
  • 100: Clarity of Power (Shadow Priest)
  • Talent Calculator
Glyphs
  • Glyph of Reflective Shield
  • Glyph of Mind Blast
  • Glyph of Mind Flay
  • Glyph of Dark Archangel
  • Glyph of the Heavens
  • Glyph of Shadow Ravens
Professions
  • mining: 700
  • enchanting: 683

Charts

http://2.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Sw%C3%A6ty+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x270&chd=t:45748|31289|30812|25335|24455|23742|16028|14702&chds=0,91497&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++45748++devouring_plague,9482C9,0,0,15|t++31289++shadow_word_death,9482C9,1,0,15|t++30812++shadow_word_pain,9482C9,2,0,15|t++25335++halo,9482C9,3,0,15|t++24455++mind_blast,9482C9,4,0,15|t++23742++vampiric_touch,9482C9,5,0,15|t++16028++mind_spike,4A79D3,6,0,15|t++14702++insanity,9482C9,7,0,15& http://3.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Sw%C3%A6ty+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:26,21,14,10,9,7,4,3,3,2,2,1&chds=0,100&chdls=ffffff&chco=9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,9482C9&chl=mind_blast|mind_spike|insanity|devouring_plague|devouring_plague_tick|shadow_word_death|shadow_word_pain|halo_damage|vampiric_touch|shadowfiend: melee|shattered_bleed|shadowy_apparitions&
http://5.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Sw%C3%A6ty+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:knqwwzz1771435514530141yz221x02zyyxwsopnokmmnlnpnnnprppoptsrpppqnlkjnkjgeggiighlmnllnprtppqvsqqqrqomlknljgffhhigilmmllnqrqnoqurrrprpnlkmnkifgiijiillmnlmpsqpopttrqqpronmmonljffhkkjknprtqsuvwuvwy01zxxwyvtsqstrpnoqqrqruvwwuwy01zyz22100110yxxzyxvuuvwwvwyzzzz0122012434434432223331123332333433445434455544555555566555666556676666766667766666666456543333221121zzyxwvtssspmjhfcaXUS&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.769891,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=23106|max=30013&chxp=1,1,77,100 http://8.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Sw%C3%A6ty+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:2,2,11,14,28,67,109,196,274,398,621,735,957,1230,1375,1569,1689,1873,1780,1693,1685,1474,1390,1150,968,828,639,577,471,330,257,175,131,104,75,42,24,17,13,9,5,6,4,1,0,0,0,1,0,1&chds=0,1873&chbh=5&chxt=x&chxl=0:|min=21133|avg=23106|max=26306&chxp=0,1,38,100& http://4.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Sw%C3%A6ty+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:29.3,24.1,22.1,9.4,5.1,3.1,3.1,3.0,0.8&chds=0,100&chdls=ffffff&chco=4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_spike 88.2s|mind_blast 72.6s|insanity 66.6s|devouring_plague 28.3s|shadow_word_death 15.4s|shadow_word_pain 9.5s|vampiric_touch 9.4s|halo 8.9s|shadowfiend 2.5s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Swæty 23106
devouring_plague 2171 (4301) 9.4% (18.6%) 21.3 13.56sec 60716 45748 Direct 21.3 24160 48327 28702 18.8% 4.8 7246 14497 18.8%  

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.31 21.31 0.00 0.00 1.3272 0.0000 653187.18 653187.18 0.00 45748.38 45748.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.91 18.81% 14496.83 13097 18402 8614.81 0 18402 13142 13142 0.00
multistrike 3.91 81.19% 7245.80 6548 9201 7113.72 0 9201 28358 28358 0.00
hit 17.31 81.20% 24159.76 21828 30669 24175.68 22155 26485 418107 418107 0.00
crit 4.01 18.80% 48327.11 43655 61339 47674.45 0 61339 193580 193580 0.00
 
DPS Timeline Chart
 

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=5&talent.surge_of_darkness.enabled
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:
  • description:Consumes 3 Shadow Orbs to deal {$s1=3163} Shadow damage and then an additional {$s2=100}% of the initial damage over {$158831d=6 seconds}. Heals the caster for {$s3=100}% of damage done.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    devouring_plague_tick 2129 9.2% 26.1 10.95sec 24520 0 Periodic 156.1 4105 0 4105 0.0% 0.0 0 0 0.0% 38.1%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.13 0.00 129.96 156.09 0.0000 0.8811 640760.01 0.00 0.00 5595.77 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 156.1 100.00% 4105.02 0 14020 4107.76 3364 5559 640760 0 0.00
 
DPS Timeline Chart
 

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:
  • description:Consumes 3 Shadow Orbs to deal {$s1=3163} Shadow damage and then an additional {$s2=100}% of the initial damage over {$158831d=6 seconds}. Heals the caster for {$s3=100}% of damage done.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
halo 0 (755) 0.0% (3.3%) 6.8 46.76sec 33205 25335

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.83 6.83 0.00 0.00 1.3108 0.0000 0.00 0.00 0.00 25334.58 25334.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.55 81.24% 0.00 0 0 0.00 0 0 0 0 0.00
crit 1.28 18.76% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1600.0
  • cooldown:40.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled&target.distance<=30&active_enemies>2
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s1=3440} Shadow damage to enemies, with the greatest effect at 25 yds.
 
    halo_damage 755 3.3% 6.8 46.76sec 33205 0 Direct 6.8 26156 52361 31073 18.8% 1.6 7847 15696 18.6%  

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.83 6.83 0.00 0.00 0.0000 0.0000 226693.86 226693.86 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.29 18.61% 15696.22 14247 20019 3988.37 0 20019 4570 4570 0.00
multistrike 1.27 81.39% 7847.27 7124 10010 5788.33 0 10010 9992 9992 0.00
hit 5.55 81.24% 26155.62 23745 33365 26161.03 0 33365 145062 145062 0.00
crit 1.28 18.76% 52361.33 47491 66730 39526.46 0 66730 67070 67070 0.00
 
DPS Timeline Chart
 

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s1=3440} Shadow damage to enemies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.264000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
insanity 3259 14.1% 34.8 7.96sec 28147 14702 Periodic 93.7 8242 16485 9788 18.8% 21.2 2473 4946 18.7% 20.5%

Stats details: insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.81 34.81 93.73 93.73 1.9145 0.6577 979822.01 979822.01 0.00 14702.33 14702.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.81 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 4.0 18.71% 4945.63 4609 6476 4846.89 0 6476 19649 19649 0.00
multistrike 17.3 81.29% 2472.67 2305 3238 2473.55 2305 2888 42671 42671 0.00
hit 76.1 81.24% 8241.73 7682 10794 8245.14 7909 8654 627590 627590 0.00
crit 17.6 18.76% 16484.88 15364 21588 16491.14 15364 18860 289911 289911 0.00
 
DPS Timeline Chart
 

Action details: insanity

Static Values
  • id:129197
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1600.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_insanity.remains<0.5*gcd&active_enemies<=2
Spelldata
  • id:129197
  • name:Insanity
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted {$120587s1=15}% increased movement speed for {$120587d=5 seconds}, stacking up to {$120587u=3} times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.300000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.75
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
mind_blast 5908 25.6% 55.6 5.46sec 31938 24455 Direct 55.6 25166 50320 29907 18.9% 12.6 7547 15109 18.8%  

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.60 55.60 0.00 0.00 1.3060 0.0000 1775686.07 1775686.07 0.00 24455.12 24455.12
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.36 18.77% 15108.55 13829 19431 13711.38 0 19431 35705 35705 0.00
multistrike 10.23 81.23% 7547.05 6914 9715 7550.49 0 9715 77189 77189 0.00
hit 45.12 81.15% 25165.54 23048 32385 25178.47 24236 26170 1135404 1135404 0.00
crit 10.48 18.85% 50319.81 46096 64770 50343.84 46096 64770 527388 527388 0.00
 
DPS Timeline Chart
 

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:400.0
  • cooldown:6.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:glyph.mind_harvest.enabled&shadow_orb<=2&active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=1898} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.{$?s162532=false}[ The first time you hit an enemy with Mind Blast, you gain {$162532s1=2} additional $LOrb:Orbs;.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
mind_spike 4704 20.4% 70.0 4.20sec 20182 16028 Direct 70.0 15913 31825 18899 18.8% 15.9 4774 9548 18.8%  

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.05 70.05 0.00 0.00 1.2592 0.0000 1413650.51 1413650.51 0.00 16027.97 16027.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.98 18.79% 9547.53 6339 12469 9038.04 0 12469 28434 28434 0.00
multistrike 12.87 81.21% 4774.20 3170 6235 4775.68 4120 5693 61460 61460 0.00
hit 56.90 81.24% 15913.43 10565 20782 15917.98 15345 16554 905546 905546 0.00
crit 13.14 18.76% 31825.26 21130 41565 31836.66 27892 37091 418211 418211 0.00
 
DPS Timeline Chart
 

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:191.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=871} Shadowfrost damage, but extinguishes your damage over time effects on the target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.825000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
shadow_word_death 1601 6.9% 11.4 5.38sec 42441 31289 Direct 11.4 33468 66967 39748 18.7% 2.6 10047 20100 18.7%  

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.35 11.35 0.00 0.00 1.3565 0.0000 481782.35 481791.43 0.00 31288.63 31288.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.48 18.73% 20100.11 13553 23183 7678.90 0 23183 9642 9642 0.00
multistrike 2.08 81.27% 10046.95 6776 11591 8850.74 0 11591 20918 20919 0.01
hit 9.22 81.25% 33468.32 22589 38639 33496.05 26203 38639 308705 308712 0.00
crit 2.13 18.75% 66967.39 45178 77279 60386.26 0 77279 142518 142519 0.00
 
DPS Timeline Chart
 

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:800.0
  • cooldown:8.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.health.pct<20&shadow_orb<=4
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=1706} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}&!s157218[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
shadow_word_pain 836 (970) 3.6% (4.2%) 7.2 32.82sec 40458 30812 Direct 7.2 3659 7315 4342 18.7% 1.6 1098 2195 18.6%  
Periodic 50.0 3428 6855 4070 18.7% 11.3 1075 2149 18.8% 43.5%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.20 7.20 49.95 49.95 1.3132 2.6222 251150.61 251150.61 0.00 2075.17 30811.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.30 18.55% 2194.52 2074 2534 574.53 0 2534 660 660 0.00
multistrike 1.32 81.45% 1098.23 1037 1267 816.80 0 1267 1449 1449 0.00
hit 5.86 81.33% 3659.42 3457 4223 3660.33 3457 4099 21440 21440 0.00
crit 1.34 18.67% 7315.14 6913 8447 5624.45 0 8447 9838 9838 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.1 18.82% 2149.45 2074 2914 1892.86 0 2914 4576 4576 0.00
multistrike 9.2 81.18% 1074.54 1037 1457 1074.61 0 1325 9865 9865 0.00
hit 40.6 81.26% 3427.89 2270 4857 3428.56 3292 3664 139137 139137 0.00
crit 9.4 18.74% 6855.32 4541 9714 6855.34 4541 8262 64186 64186 0.00
 
DPS Timeline Chart
 

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:400.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.auspicious_spirits.enabled&remains<(18*0.3)&miss_react
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w2 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes {$s1=502} Shadow damage and an additional $o2 Shadow damage over {$d=18 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.475000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.475000
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    shadowy_apparitions 134 0.6% 9.4 22.61sec 4304 0 Direct 9.4 3392 6783 4027 18.7% 2.1 1018 2034 18.8%  

Stats details: shadowy_apparitions

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.36 9.36 0.00 0.00 0.0000 0.0000 40298.13 40298.13 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.40 18.77% 2033.89 1964 2760 666.20 0 2760 819 819 0.00
multistrike 1.74 81.23% 1017.67 982 1380 828.34 0 1380 1773 1773 0.00
hit 7.61 81.28% 3392.44 3274 4600 3390.82 0 4182 25818 25818 0.00
crit 1.75 18.72% 6783.19 6547 9199 5599.34 0 9199 11888 11888 0.00
 
DPS Timeline Chart
 

Action details: shadowy_apparitions

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When your Shadow Word: Pain damage over time critically strikes, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=474} Shadow damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
shattered_bleed 389 1.7% 17.0 18.05sec 6881 0 Direct 17.0 1676 3352 1989 18.7% 3.9 503 1005 18.8%  
Periodic 95.8 789 0 789 0.0% 21.7 239 0 0.0% 31.8%

Stats details: shattered_bleed

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.99 16.99 95.82 95.82 0.0000 1.0000 116894.89 116894.89 0.00 1219.92 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.73 18.84% 1005.33 958 1101 517.87 0 1101 732 732 0.00
multistrike 3.14 81.16% 502.61 479 551 478.96 0 551 1577 1577 0.00
hit 13.81 81.31% 1675.97 1596 1836 1675.63 1596 1801 23152 23152 0.00
crit 3.18 18.69% 3352.07 3192 3671 3222.63 0 3671 10644 10644 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike 21.7 100.00% 239.42 239 239 239.42 239 239 5191 5191 0.00
hit 95.8 100.00% 788.96 1 798 789.24 761 798 75600 75600 0.00
 
DPS Timeline Chart
 

Action details: shattered_bleed

Static Values
  • id:159238
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:159238
  • name:Shattered Bleed
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2.
  • description:Inflicts {$s1=1500} Bleed damage, plus an additional $o2 damage over {$d=6 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1499.91
  • base_dd_max:1499.91
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:749.87
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
vampiric_touch 744 3.2% 7.2 32.97sec 31171 23742 Periodic 42.5 4123 8248 4897 18.8% 9.6 1325 2650 18.9% 37.1%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.17 7.17 42.53 42.53 1.3130 2.6229 223431.40 223431.40 0.00 1846.94 23741.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.17 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.8 18.89% 2649.64 2554 3589 2227.69 0 3589 4818 4818 0.00
multistrike 7.8 81.11% 1324.75 1277 1794 1324.45 0 1794 10345 10345 0.00
hit 34.6 81.24% 4122.89 2330 5981 4124.33 3897 4481 142472 142472 0.00
crit 8.0 18.76% 8247.70 4660 11962 8247.21 0 10557 65796 65796 0.00
 
DPS Timeline Chart
 

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:608.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<(15*0.3+cast_time)&miss_react&active_enemies<=5
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.585000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - shadowfiend 5841 / 476
melee 5841 2.0% 20.0 10.28sec 7023 6309 Direct 20.0 5534 11070 6576 18.8% 4.5 1661 3319 18.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.04 20.04 0.00 0.00 1.1132 0.0000 140726.99 140726.99 0.00 6308.93 6308.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.85 18.81% 3318.75 2619 3680 1921.17 0 3680 2835 2835 0.00
multistrike 3.69 81.19% 1660.93 1309 1840 1627.56 0 1840 6125 6125 0.00
hit 16.26 81.17% 5533.78 4365 6133 5533.85 5213 5886 90001 90001 0.00
crit 3.77 18.83% 11069.52 8729 12266 10899.22 0 12266 41767 41767 0.00
 
DPS Timeline Chart
 

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Simple Action Stats Execute Interval
Swæty
draenic_intellect_potion 2.0 0.00sec

Stats details: draenic_intellect_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156426
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156426
  • name:Draenic Intellect Potion
  • school:physical
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
 
shadowfiend 2.0 180.87sec

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.04 2.04 0.00 0.00 1.2036 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.66 81.34% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.38 18.66% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Lasts {$d=12 seconds}.
 
shadowform 1.0 0.00sec

Stats details: shadowform

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.82 81.55% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.18 18.45% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: shadowform

Static Values
  • id:15473
  • school:shadow
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4160.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.shadowform.up
Spelldata
  • id:15473
  • name:Shadowform
  • school:shadow
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s3=100}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}% and increasing your armor by {$s3=100}%. However, you may not cast any healing spells while in this form.
 
pet - shadowfiend
shadowcrawl 6.0 39.63sec

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.04 6.04 0.00 0.00 1.2023 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.91 81.27% 0.00 0 0 0.00 0 0 0 0 0.00
crit 1.13 18.73% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 37.51% 0.0(0.0)

Buff details

  • buff initial source:Swæty
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
draenic_intellect_potion 2.0 0.0 260.9sec 0.0sec 15.21% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Swæty
  • cooldown name:buff_draenic_intellect_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:1000.00

Stack Uptimes

  • draenic_intellect_potion_1:15.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156426
  • name:Draenic Intellect Potion
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
glyph_of_mind_flay 1.0 92.7 0.0sec 2.9sec 91.95% 91.95% 92.7(92.7)

Buff details

  • buff initial source:Swæty
  • cooldown name:buff_glyph_of_mind_flay
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

  • glyph_of_mind_flay_1:91.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120585
  • name:Glyph of Mind Flay
  • tooltip:
  • description:Your Mind Flay spell no longer slows your victim's movement speed. Instead, each time Mind Flay deals damage you will be granted {$120587s1=15}% increased movement speed for {$120587d=5 seconds}, stacking up to {$120587u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
shadow_word_death_reset_cooldown 5.7 0.0 11.4sec 11.4sec 15.93% 49.51% 0.0(0.0)

Buff details

  • buff initial source:Swæty
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:15.93%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_insanity 21.3 0.0 13.6sec 13.6sec 36.84% 30.63% 0.0(0.0)

Buff details

  • buff initial source:Swæty
  • cooldown name:buff_shadow_word_insanity
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_insanity_1:36.84%

Trigger Attempt Success

  • trigger_pct:100.00%
twist_of_fate 1.0 91.6 0.0sec 1.2sec 36.15% 36.16% 91.6(91.6)

Buff details

  • buff initial source:Swæty
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:36.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After {$?s15407=true}[damaging][healing] a target below {$s1=35}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
(shadowfiend-) shadowfiend-shadowcrawl 6.0 0.0 39.6sec 39.6sec 83.37% 80.03% 0.0(0.0)

Buff details

  • buff initial source:Swæty_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:0
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_intellect_flask

Buff details

  • buff initial source:Swæty
  • cooldown name:buff_greater_draenic_intellect_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:250.00

Stack Uptimes

  • greater_draenic_intellect_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156079
  • name:Greater Draenic Intellect Flask
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
shadowform

Buff details

  • buff initial source:Swæty
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s3=100}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}% and increasing your armor by {$s3=100}%. However, you may not cast any healing spells while in this form.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Swæty
devouring_plague Shadow Orb 21.3 63.9 3.0 3.0 20238.8
halo Mana 6.8 10923.2 1600.0 1600.0 20.8
insanity Mana 34.8 55697.0 1600.0 1600.0 17.6
mind_blast Mana 55.6 22239.1 400.0 400.0 79.8
mind_spike Mana 70.0 13378.7 191.0 191.0 105.7
shadow_word_death Mana 11.4 9081.5 800.0 800.0 53.1
shadow_word_pain Mana 7.2 2881.5 400.0 400.0 101.1
vampiric_touch Mana 7.2 4358.1 608.0 608.0 51.3
Resource Gains Type Count Total Average Overflow
Devouring Plague Health Health 156.09 0.00 (0.00%) 0.00 1293938.81 100.00%
Shadow Orbs from Mind Blast Shadow Orb 55.60 55.60 (83.04%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 11.35 11.35 (16.96%) 1.00 0.00 0.00%
external_healing Health 48.10 0.00 (0.00%) 0.00 325649.92 100.00%
mp5_regen Mana 199.27 117772.27 (100.00%) 591.02 74346.12 38.70%
Resource RPS-Gain RPS-Loss
Mana 391.35 393.97
Shadow Orb 0.22 0.21
Combat End Resource Mean Min Max
Mana 159206.89 156800.00 160000.00
Shadow Orb 3.03 0.00 5.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 33.7%
shadowfiend-Mana Cap 33.7%
mindbender-Mana Cap 33.7%

Procs

Count Interval
Shadowy Apparition Procced 9.4 22.6sec
Mind Spike removed DoTs 1.0 221.7sec
Mind Spike removed Devouring Plague 0.0 0.0sec
Mind Spike removed Shadow Word: Pain 1.0 221.5sec
Mind Spike removed Vampiric Touch 1.0 183.6sec
Devouring Plague ticks lost from Mind Spike removal 0.0 0.0sec
Shadow Word: Pain ticks lost from Mind Spike removal 2.0 221.5sec
Vampiric Touch ticks lost from Mind Spike removal 2.0 183.6sec

Statistics & Data Analysis

Fight Length
Sample Data Swæty Fight Length
Count 25000
Mean 300.94
Minimum 230.43
Maximum 374.11
Spread ( max - min ) 143.68
Range [ ( max - min ) / 2 * 100% ] 23.87%
DPS
Sample Data Swæty Damage Per Second
Count 25000
Mean 23106.42
Minimum 21133.49
Maximum 26305.81
Spread ( max - min ) 5172.33
Range [ ( max - min ) / 2 * 100% ] 11.19%
Standard Deviation 586.0007
5th Percentile 22196.50
95th Percentile 24119.63
( 95th Percentile - 5th Percentile ) 1923.13
Mean Distribution
Standard Deviation 3.7062
95.00% Confidence Intervall ( 23099.16 - 23113.69 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2470
0.1 Scale Factor Error with Delta=300 2931
0.05 Scale Factor Error with Delta=300 11725
0.01 Scale Factor Error with Delta=300 293143
Distribution Chart
DPS(e)
Sample Data Swæty Damage Per Second (Effective)
Count 25000
Mean 23106.42
Minimum 21133.49
Maximum 26305.81
Spread ( max - min ) 5172.33
Range [ ( max - min ) / 2 * 100% ] 11.19%
Damage
Sample Data Swæty Damage
Count 25000
Mean 6803357.03
Minimum 5023029.05
Maximum 8755541.11
Spread ( max - min ) 3732512.06
Range [ ( max - min ) / 2 * 100% ] 27.43%
DTPS
Sample Data Swæty Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Swæty Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Swæty Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Swæty Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Swæty Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Swæty Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data SwætyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Swæty Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Devouring Plague ticks lost from Mind Spike removal
Sample Data Devouring Plague ticks lost from Mind Spike removal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 1.00
Spread ( max - min ) 1.00
Range [ ( max - min ) / 2 * 100% ] 625000.00%
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_intellect_flask
1 0.00 food,type=sleeper_surprise
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 shadowform,if=!buff.shadowform.up
4 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
5 0.00 potion,name=draenic_intellect
6 0.00 mind_spike
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform,if=!buff.shadowform.up
8 1.00 potion,name=draenic_intellect,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 power_infusion,if=talent.power_infusion.enabled
A 0.00 blood_fury
B 0.00 berserking
C 0.00 arcane_torrent
D 0.00 call_action_list,name=pvp_dispersion,if=set_bonus.pvp_2pc
E 0.00 call_action_list,name=decision
actions.cop_dotweave
# count action,conditions
. 7.13 devouring_plague,if=target.dot.vampiric_touch.ticking&target.dot.shadow_word_pain.ticking&shadow_orb=5&cooldown_react
. 0.00 devouring_plague,if=(buff.mental_instinct.remains<gcd&buff.mental_instinct.remains)
. 6.84 devouring_plague,if=(target.dot.vampiric_touch.ticking&target.dot.shadow_word_pain.ticking&!buff.shadow_word_insanity.remains&cooldown.mind_blast.remains>0.4*gcd)
. 0.00 mind_blast,if=glyph.mind_harvest.enabled&mind_harvest=0&shadow_orb<=2,cycle_targets=1
. 44.84 mind_blast,if=shadow_orb<=4&cooldown_react
. 2.00 shadowfiend,if=!talent.mindbender.enabled&!buff.shadow_word_insanity.remains
. 0.00 mindbender,if=talent.mindbender.enabled&!buff.shadow_word_insanity.remains
. 0.00 shadow_word_pain,if=shadow_orb=4&set_bonus.tier17_2pc&!target.dot.shadow_word_pain.ticking&!target.dot.devouring_plague.ticking&cooldown.mind_blast.remains<1.2*gcd&cooldown.mind_blast.remains>0.2*gcd
. 7.20 shadow_word_pain,if=shadow_orb=5&!target.dot.devouring_plague.ticking&!target.dot.shadow_word_pain.ticking
. 7.17 vampiric_touch,if=shadow_orb=5&!target.dot.devouring_plague.ticking&!target.dot.vampiric_touch.ticking
. 13.84 insanity,if=buff.shadow_word_insanity.remains,chain=1,interrupt_if=cooldown.mind_blast.remains<=0.1
. 0.00 shadow_word_pain,if=shadow_orb>=2&target.dot.shadow_word_pain.remains>=6&cooldown.mind_blast.remains>0.5*gcd&target.dot.vampiric_touch.remains&buff.bloodlust.up&!set_bonus.tier17_2pc
. 0.00 vampiric_touch,if=shadow_orb>=2&target.dot.vampiric_touch.remains>=5&cooldown.mind_blast.remains>0.5*gcd&buff.bloodlust.up&!set_bonus.tier17_2pc
. 5.68 halo,if=cooldown.mind_blast.remains>0.5*gcd&talent.halo.enabled&target.distance<=30&target.distance>=17
. 0.00 divine_star,if=cooldown.mind_blast.remains>0.5&gcd&talent.divine_star.enabled&(active_enemies>1|target.distance<=24)
. 0.00 cascade,if=cooldown.mind_blast.remains>0.5*gcd&talent.cascade.enabled&((active_enemies>1|target.distance>=28)&target.distance<=40&target.distance>=11)
. 0.00 shadow_word_pain,if=primary_target=0&(!ticking|remains<=18*0.3),cycle_targets=1,max_cycle_targets=5
. 0.00 vampiric_touch,if=primary_target=0&(!ticking|remains<=15*0.3),cycle_targets=1,max_cycle_targets=5
. 16.50 mind_spike,if=buff.shadow_word_insanity.remains<=gcd&buff.bloodlust.up&!target.dot.shadow_word_pain.remains&!target.dot.vampiric_touch.remains
. 0.56 mind_spike,if=((target.dot.shadow_word_pain.remains&!target.dot.vampiric_touch.remains)|(!target.dot.shadow_word_pain.remains&target.dot.vampiric_touch.remains))&shadow_orb<=2&cooldown.mind_blast.remains>0.5*gcd
. 0.00 mind_flay,if=set_bonus.tier17_2pc&target.dot.shadow_word_pain.remains&target.dot.vampiric_touch.remains&cooldown.mind_blast.remains>0.9*gcd,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1)
. 47.44 mind_spike
. 0.00 shadow_word_death,moving=1
. 0.00 halo,if=talent.halo.enabled&target.distance<=30,moving=1
. 0.00 divine_star,if=talent.divine_star.enabled&target.distance<=28,moving=1
. 0.00 cascade,if=talent.cascade.enabled&target.distance<=40,moving=1
. 0.00 shadow_word_pain,moving=1
actions.cop_mfi
# count action,conditions
. 4.80 devouring_plague,if=shadow_orb=5
. 0.00 mind_blast,if=glyph.mind_harvest.enabled&mind_harvest=0,cycle_targets=1
. 10.76 mind_blast,if=active_enemies<=5&cooldown_react
. 11.35 shadow_word_death,if=target.health.pct<20,cycle_targets=1
. 2.54 devouring_plague,if=shadow_orb>=3&(cooldown.mind_blast.remains<gcd*1.0|target.health.pct<20&cooldown.shadow_word_death.remains<gcd*1.0)
. 0.00 mindbender,if=talent.mindbender.enabled
. 0.04 shadowfiend,if=!talent.mindbender.enabled
. 0.00 shadow_word_pain,if=remains<(18*0.3)&miss_react&active_enemies<=5&primary_target=0,cycle_targets=1,max_cycle_targets=5
. 0.00 vampiric_touch,if=remains<(15*0.3+cast_time)&miss_react&active_enemies<=5&primary_target=0,cycle_targets=1,max_cycle_targets=5
. 1.35 insanity,if=buff.shadow_word_insanity.remains<0.5*gcd&active_enemies<=2,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|(cooldown.shadow_word_death.remains<=0.1*target.health.pct<20))
. 4.41 insanity,if=active_enemies<=2,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|(cooldown.shadow_word_death.remains<=0.1*target.health.pct<20))
. 1.15 halo,if=talent.halo.enabled&target.distance<=30&target.distance>=17
. 0.00 cascade,if=talent.cascade.enabled&((active_enemies>1|target.distance>=28)&target.distance<=40&target.distance>=11)
. 0.00 divine_star,if=talent.divine_star.enabled&(active_enemies>1|target.distance<=24)
. 0.00 mind_sear,if=active_enemies>=6,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1)
. 4.67 mind_spike
. 0.00 shadow_word_death,moving=1
. 0.00 mind_blast,if=buff.shadowy_insight.react&cooldown_react,moving=1
. 0.00 halo,if=talent.halo.enabled&target.distance<=30,moving=1
. 0.00 divine_star,if=talent.divine_star.enabled&target.distance<=28,moving=1
. 0.00 cascade,if=talent.cascade.enabled&target.distance<=40,moving=1
. 0.00 shadow_word_pain,if=primary_target=0,moving=1,cycle_targets=1

Sample Sequence

01356............................................................................................................................................................................8.........................

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/5: 0% shadow_orb
Pre food Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/5: 0% shadow_orb
Pre shadowform Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/5: 0% shadow_orb
Pre potion Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/5: 0% shadow_orb draenic_intellect_potion
0:00.000 mind_spike Fluffy_Pillow 159809.0/160000: 100% mana | 0.0/5: 0% shadow_orb draenic_intellect_potion
0:00.000 mind_blast Fluffy_Pillow 159809.0/160000: 100% mana | 0.0/5: 0% shadow_orb draenic_intellect_potion
0:01.357 shadowfiend Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb bloodlust, draenic_intellect_potion
0:02.400 halo Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb bloodlust, draenic_intellect_potion
0:03.444 mind_spike Fluffy_Pillow 159068.2/160000: 99% mana | 1.0/5: 20% shadow_orb bloodlust, draenic_intellect_potion
0:04.489 mind_spike Fluffy_Pillow 159546.0/160000: 100% mana | 1.0/5: 20% shadow_orb bloodlust, draenic_intellect_potion
0:05.534 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb bloodlust, draenic_intellect_potion
0:06.579 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb bloodlust, draenic_intellect_potion
0:07.623 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb bloodlust, draenic_intellect_potion
0:08.667 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb bloodlust, draenic_intellect_potion
0:09.710 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb bloodlust, draenic_intellect_potion
0:10.754 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb bloodlust, draenic_intellect_potion
0:11.799 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb bloodlust, draenic_intellect_potion
0:12.844 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb bloodlust, draenic_intellect_potion
0:13.889 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb bloodlust, draenic_intellect_potion
0:14.936 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb bloodlust, draenic_intellect_potion
0:15.980 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb bloodlust, draenic_intellect_potion
0:17.025 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb bloodlust, draenic_intellect_potion
0:18.070 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb bloodlust, draenic_intellect_potion
0:19.114 shadow_word_pain Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb bloodlust, draenic_intellect_potion
0:20.158 vampiric_touch Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb bloodlust
0:21.204 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb bloodlust
0:22.251 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb bloodlust, shadow_word_insanity
0:23.297 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb bloodlust, shadow_word_insanity
0:26.645 mind_blast Fluffy_Pillow 158942.7/160000: 99% mana | 3.0/5: 60% shadow_orb bloodlust, glyph_of_mind_flay
0:27.690 devouring_plague Fluffy_Pillow 159211.5/160000: 100% mana | 4.0/5: 80% shadow_orb bloodlust, glyph_of_mind_flay
0:28.734 insanity Fluffy_Pillow 159879.7/160000: 100% mana | 1.0/5: 20% shadow_orb bloodlust, shadow_word_insanity, glyph_of_mind_flay
0:31.518 mind_blast Fluffy_Pillow 158461.4/160000: 99% mana | 1.0/5: 20% shadow_orb bloodlust, shadow_word_insanity, glyph_of_mind_flay
0:32.563 mind_spike Fluffy_Pillow 158730.2/160000: 99% mana | 2.0/5: 40% shadow_orb bloodlust, glyph_of_mind_flay
0:33.609 mind_spike Fluffy_Pillow 159208.7/160000: 100% mana | 2.0/5: 40% shadow_orb bloodlust, glyph_of_mind_flay
0:34.654 mind_spike Fluffy_Pillow 159686.5/160000: 100% mana | 2.0/5: 40% shadow_orb bloodlust, glyph_of_mind_flay
0:35.697 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb bloodlust, glyph_of_mind_flay
0:36.741 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb bloodlust, glyph_of_mind_flay
0:37.785 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb bloodlust, glyph_of_mind_flay
0:38.830 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb bloodlust, glyph_of_mind_flay
0:39.874 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb bloodlust, glyph_of_mind_flay
0:40.919 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb bloodlust, glyph_of_mind_flay
0:41.964 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
0:43.320 halo Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
0:44.677 mind_blast Fluffy_Pillow 159268.5/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
0:46.034 shadow_word_pain Fluffy_Pillow 159737.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
0:47.390 vampiric_touch Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
0:48.745 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
0:50.102 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, glyph_of_mind_flay
0:51.460 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_insanity, glyph_of_mind_flay
0:55.753 mind_blast Fluffy_Pillow 159547.5/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
0:57.109 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
0:58.465 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
1:02.121 mind_blast Fluffy_Pillow 159139.8/160000: 99% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
1:03.478 mind_spike Fluffy_Pillow 159608.3/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
1:04.834 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
1:06.191 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
1:07.548 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
1:08.904 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
1:10.260 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
1:11.618 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
1:12.975 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
1:14.331 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
1:15.687 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
1:17.043 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
1:18.400 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
1:19.757 shadow_word_pain Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
1:21.114 vampiric_touch Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
1:22.472 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
1:23.831 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, glyph_of_mind_flay
1:25.188 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_insanity, glyph_of_mind_flay
1:29.387 mind_blast Fluffy_Pillow 159487.4/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
1:30.744 devouring_plague Fluffy_Pillow 159955.8/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
1:32.101 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
1:35.694 mind_blast Fluffy_Pillow 159099.5/160000: 99% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
1:37.050 halo Fluffy_Pillow 159567.4/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
1:38.408 mind_spike Fluffy_Pillow 158836.5/160000: 99% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
1:39.764 mind_spike Fluffy_Pillow 159513.3/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
1:41.121 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
1:42.478 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
1:43.835 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
1:45.191 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
1:46.548 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
1:47.904 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
1:49.261 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
1:50.617 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
1:51.974 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
1:53.331 shadow_word_pain Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
1:54.686 vampiric_touch Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
1:56.044 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
1:57.401 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, glyph_of_mind_flay
1:58.759 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_insanity, glyph_of_mind_flay
2:03.072 mind_blast Fluffy_Pillow 159560.3/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
2:04.428 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
2:05.784 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
2:09.498 mind_blast Fluffy_Pillow 159177.0/160000: 99% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
2:10.855 mind_spike Fluffy_Pillow 159645.4/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
2:12.211 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
2:13.569 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
2:14.925 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
2:16.282 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
2:17.639 halo Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
2:18.996 mind_spike Fluffy_Pillow 159268.5/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
2:20.353 mind_blast Fluffy_Pillow 159946.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
2:21.709 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
2:23.065 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
2:24.422 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
2:25.777 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
2:27.134 shadow_word_pain Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
2:28.492 vampiric_touch Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
2:29.850 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
2:31.206 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, glyph_of_mind_flay
2:32.561 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_insanity, glyph_of_mind_flay
2:36.733 mind_blast Fluffy_Pillow 159470.1/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
2:38.090 devouring_plague Fluffy_Pillow 159938.6/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
2:39.447 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
2:43.045 mind_blast Fluffy_Pillow 159102.7/160000: 99% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
2:44.402 mind_spike Fluffy_Pillow 159571.2/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
2:45.760 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
2:47.118 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
2:48.474 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
2:49.830 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
2:51.187 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
2:52.542 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
2:53.899 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
2:55.255 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
2:56.612 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
2:57.967 halo Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
2:59.322 mind_blast Fluffy_Pillow 159267.2/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
3:00.679 shadow_word_pain Fluffy_Pillow 159735.7/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
3:02.037 shadowfiend Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
3:03.393 vampiric_touch Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
3:04.750 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
3:06.107 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, glyph_of_mind_flay
3:07.464 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_insanity, glyph_of_mind_flay
3:11.712 mind_blast Fluffy_Pillow 159518.7/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
3:13.069 devouring_plague Fluffy_Pillow 159987.2/160000: 100% mana | 4.0/5: 80% shadow_orb twist_of_fate, glyph_of_mind_flay
3:14.426 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb twist_of_fate, shadow_word_insanity, glyph_of_mind_flay
3:18.004 mind_blast Fluffy_Pillow 159089.9/160000: 99% mana | 1.0/5: 20% shadow_orb twist_of_fate, shadow_word_insanity, glyph_of_mind_flay
3:19.362 mind_spike Fluffy_Pillow 159559.0/160000: 100% mana | 2.0/5: 40% shadow_orb twist_of_fate, glyph_of_mind_flay
3:20.717 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb twist_of_fate, glyph_of_mind_flay
3:22.074 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb twist_of_fate, glyph_of_mind_flay
3:23.432 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb twist_of_fate, glyph_of_mind_flay
3:24.787 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb twist_of_fate, glyph_of_mind_flay
3:26.142 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb twist_of_fate, glyph_of_mind_flay
3:27.498 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb twist_of_fate, glyph_of_mind_flay
3:28.855 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb twist_of_fate, glyph_of_mind_flay
3:30.212 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb twist_of_fate, glyph_of_mind_flay
3:31.570 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb twist_of_fate, glyph_of_mind_flay
3:32.926 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb twist_of_fate, glyph_of_mind_flay
3:34.283 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb twist_of_fate, glyph_of_mind_flay
3:35.639 shadow_word_pain Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb twist_of_fate, glyph_of_mind_flay
3:36.996 vampiric_touch Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb twist_of_fate, glyph_of_mind_flay
3:38.354 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb twist_of_fate, glyph_of_mind_flay
3:39.710 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb twist_of_fate, shadow_word_insanity, glyph_of_mind_flay
3:41.066 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb twist_of_fate, shadow_word_insanity, glyph_of_mind_flay
3:45.468 mind_blast Fluffy_Pillow 159617.3/160000: 100% mana | 3.0/5: 60% shadow_orb twist_of_fate, glyph_of_mind_flay
3:46.824 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb twist_of_fate, glyph_of_mind_flay
3:48.180 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb twist_of_fate, shadow_word_insanity, glyph_of_mind_flay
3:51.796 mind_blast Fluffy_Pillow 159114.2/160000: 99% mana | 1.0/5: 20% shadow_orb twist_of_fate, shadow_word_insanity, glyph_of_mind_flay
3:53.153 halo Fluffy_Pillow 159582.7/160000: 100% mana | 2.0/5: 40% shadow_orb twist_of_fate, glyph_of_mind_flay
3:54.511 mind_spike Fluffy_Pillow 158851.8/160000: 99% mana | 2.0/5: 40% shadow_orb twist_of_fate, glyph_of_mind_flay
3:55.867 mind_spike Fluffy_Pillow 159528.7/160000: 100% mana | 2.0/5: 40% shadow_orb twist_of_fate, glyph_of_mind_flay
3:57.224 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb twist_of_fate, glyph_of_mind_flay
3:58.580 shadow_word_death Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb twist_of_fate, glyph_of_mind_flay
3:59.936 shadow_word_death Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb twist_of_fate, shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:01.292 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb twist_of_fate, shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:02.650 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb twist_of_fate, shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:04.008 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb twist_of_fate, shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:06.282 insanity Fluffy_Pillow 159855.4/160000: 100% mana | 3.0/5: 60% shadow_orb twist_of_fate, shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:07.853 devouring_plague Fluffy_Pillow 159260.8/160000: 100% mana | 3.0/5: 60% shadow_orb twist_of_fate, glyph_of_mind_flay
4:09.211 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/5: 0% shadow_orb twist_of_fate, shadow_word_insanity, glyph_of_mind_flay
4:10.566 shadow_word_death Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb twist_of_fate, shadow_word_insanity, glyph_of_mind_flay
4:11.922 shadow_word_death Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb twist_of_fate, shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:13.276 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb twist_of_fate, shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:14.632 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb twist_of_fate, shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:15.988 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb twist_of_fate, shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:17.344 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb twist_of_fate, shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:18.702 potion Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb twist_of_fate, shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:18.702 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb twist_of_fate, shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:20.059 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb twist_of_fate, shadow_word_insanity, glyph_of_mind_flay, draenic_intellect_potion
4:21.416 shadow_word_death Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb twist_of_fate, shadow_word_insanity, glyph_of_mind_flay, draenic_intellect_potion
4:22.772 shadow_word_death Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb twist_of_fate, shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:24.129 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb twist_of_fate, shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:25.487 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb twist_of_fate, shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:26.843 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb twist_of_fate, shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:28.200 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb twist_of_fate, shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:31.822 mind_blast Fluffy_Pillow 159118.1/160000: 99% mana | 2.0/5: 40% shadow_orb twist_of_fate, shadow_word_insanity, glyph_of_mind_flay, draenic_intellect_potion
4:33.177 shadow_word_death Fluffy_Pillow 159585.3/160000: 100% mana | 3.0/5: 60% shadow_orb twist_of_fate, glyph_of_mind_flay, draenic_intellect_potion
4:34.532 shadow_word_death Fluffy_Pillow 159652.5/160000: 100% mana | 4.0/5: 80% shadow_orb twist_of_fate, shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:35.889 devouring_plague Fluffy_Pillow 159721.0/160000: 100% mana | 5.0/5: 100% shadow_orb twist_of_fate, shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:37.245 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb twist_of_fate, shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:38.600 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb twist_of_fate, shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:40.916 insanity Fluffy_Pillow 159882.2/160000: 100% mana | 3.0/5: 60% shadow_orb twist_of_fate, shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:42.638 shadow_word_death Fluffy_Pillow 159384.3/160000: 100% mana | 3.0/5: 60% shadow_orb twist_of_fate, glyph_of_mind_flay, draenic_intellect_potion
4:43.994 mind_blast Fluffy_Pillow 159452.2/160000: 100% mana | 4.0/5: 80% shadow_orb twist_of_fate, shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:45.351 devouring_plague Fluffy_Pillow 159920.6/160000: 100% mana | 5.0/5: 100% shadow_orb twist_of_fate, shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:46.707 shadow_word_death Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb twist_of_fate, shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:48.063 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb twist_of_fate, shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:49.737 mind_blast Fluffy_Pillow 159471.4/160000: 100% mana | 3.0/5: 60% shadow_orb twist_of_fate, shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:51.093 halo Fluffy_Pillow 159939.2/160000: 100% mana | 4.0/5: 80% shadow_orb twist_of_fate, shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:52.449 mind_spike Fluffy_Pillow 159207.0/160000: 100% mana | 4.0/5: 80% shadow_orb twist_of_fate, glyph_of_mind_flay
4:53.805 devouring_plague Fluffy_Pillow 159883.9/160000: 100% mana | 4.0/5: 80% shadow_orb twist_of_fate, glyph_of_mind_flay
4:55.160 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb twist_of_fate, shadow_word_insanity, glyph_of_mind_flay

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 880 839 839
Agility 1124 1071 1071
Stamina 4148 3771 3771
Intellect 3918 3470 3357 (2263)
Spirit 782 782 782
Health 248880 226260 0
Mana 160000 160000 0
Shadow Orb 5 5 0
Spell Power 5469 4524 1054
Crit 21.77% 16.77% 1295
Haste 10.92% 5.64% 459
Multistrike 11.33% 6.33% 418
Damage / Heal Versatility 6.41% 3.41% 443
ManaReg per Second 640 640 0
Mastery 48.00% 33.23% 582
Armor 1206 603 603
Run Speed 0 0 82

Talents

Level
15 Desperate Prayer Spectral Guise Angelic Bulwark
30 Body and Soul Angelic Feather Phantasm
45 Surge of Darkness (Shadow Priest) Mindbender Insanity (Shadow Priest)
60 Void Tendrils Psychic Scream Dominate Mind
75 Twist of Fate Power Infusion Shadowy Insight (Shadow Priest)
90 Cascade (Shadow Priest) Divine Star (Shadow Priest) Halo (Shadow Priest)
100 Clarity of Power (Shadow Priest) Void Entropy (Shadow Priest) Auspicious Spirits (Shadow Priest)

Profile

priest="Swæty"
origin="http://eu.battle.net/wow/en/character/forscherliga/Swæty/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/13/55890701-avatar.jpg"
level=100
race=night_elf
role=spell
position=back
professions=enchanting=683/mining=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Xb!2022020
glyphs=reflective_shield/mind_blast/mind_flay/dark_archangel/heavens/shadow_ravens
spec=shadow

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_intellect_flask
actions.precombat+=/food,type=sleeper_surprise
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/shadowform,if=!buff.shadowform.up
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=draenic_intellect
actions.precombat+=/mind_spike

# Executed every time the actor is available.

actions=shadowform,if=!buff.shadowform.up
actions+=/potion,name=draenic_intellect,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/call_action_list,name=pvp_dispersion,if=set_bonus.pvp_2pc
actions+=/call_action_list,name=decision

actions.decision=call_action_list,name=cop_dotweave,if=talent.clarity_of_power.enabled&talent.insanity.enabled&target.health.pct>20&active_enemies<=5
actions.decision+=/call_action_list,name=cop_mfi,if=talent.clarity_of_power.enabled&talent.insanity.enabled&target.health.pct<=20
actions.decision+=/call_action_list,name=cop,if=talent.clarity_of_power.enabled
actions.decision+=/call_action_list,name=vent,if=talent.void_entropy.enabled
actions.decision+=/call_action_list,name=main

actions.pvp_dispersion=call_action_list,name=decision,if=cooldown.dispersion.remains>0
actions.pvp_dispersion+=/dispersion,interrupt=1
actions.pvp_dispersion+=/call_action_list,name=decision

actions.main=mindbender,if=talent.mindbender.enabled
actions.main+=/shadowfiend,if=!talent.mindbender.enabled
actions.main+=/shadow_word_death,if=target.health.pct<20&shadow_orb<=4,cycle_targets=1
actions.main+=/mind_blast,if=glyph.mind_harvest.enabled&shadow_orb<=2&active_enemies<=5&cooldown_react
actions.main+=/devouring_plague,if=shadow_orb=5&talent.surge_of_darkness.enabled,cycle_targets=1
actions.main+=/devouring_plague,if=shadow_orb=5
actions.main+=/devouring_plague,if=shadow_orb>=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)&!target.dot.devouring_plague_tick.ticking&talent.surge_of_darkness.enabled,cycle_targets=1
actions.main+=/devouring_plague,if=shadow_orb>=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions.main+=/mind_blast,if=glyph.mind_harvest.enabled&mind_harvest=0,cycle_targets=1
actions.main+=/mind_blast,if=active_enemies<=5&cooldown_react
actions.main+=/insanity,if=buff.shadow_word_insanity.remains<0.5*gcd&active_enemies<=2,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1|shadow_orb=5)
actions.main+=/insanity,chain=1,if=active_enemies<=2,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1|shadow_orb=5)
actions.main+=/halo,if=talent.halo.enabled&target.distance<=30&active_enemies>2
actions.main+=/cascade,if=talent.cascade.enabled&active_enemies>2&target.distance<=40
actions.main+=/divine_star,if=talent.divine_star.enabled&active_enemies>4&target.distance<=24
actions.main+=/shadow_word_pain,if=talent.auspicious_spirits.enabled&remains<(18*0.3)&miss_react,cycle_targets=1
actions.main+=/shadow_word_pain,if=!talent.auspicious_spirits.enabled&remains<(18*0.3)&miss_react&active_enemies<=5,cycle_targets=1,max_cycle_targets=5
actions.main+=/vampiric_touch,if=remains<(15*0.3+cast_time)&miss_react&active_enemies<=5,cycle_targets=1,max_cycle_targets=5
actions.main+=/devouring_plague,if=!talent.void_entropy.enabled&shadow_orb>=3&ticks_remain<=1
actions.main+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=3
actions.main+=/halo,if=talent.halo.enabled&target.distance<=30&target.distance>=17
actions.main+=/cascade,if=talent.cascade.enabled&((active_enemies>1|target.distance>=28)&target.distance<=40&target.distance>=11)
actions.main+=/divine_star,if=talent.divine_star.enabled&(active_enemies>1|target.distance<=24)
actions.main+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions.main+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&cooldown.mind_blast.remains&active_enemies<=1
actions.main+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions.main+=/divine_star,if=talent.divine_star.enabled&target.distance<=28&active_enemies>1
actions.main+=/mind_sear,chain=1,if=active_enemies>=4,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1|shadow_orb=5)
actions.main+=/shadow_word_pain,if=shadow_orb>=2&ticks_remain<=3&talent.insanity.enabled
actions.main+=/vampiric_touch,if=shadow_orb>=2&ticks_remain<=3.5&talent.insanity.enabled
actions.main+=/mind_flay,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1|shadow_orb=5)
actions.main+=/mind_blast,moving=1,if=buff.shadowy_insight.react&cooldown_react
actions.main+=/divine_star,moving=1,if=talent.divine_star.enabled&target.distance<=28
actions.main+=/cascade,moving=1,if=talent.cascade.enabled&target.distance<=40
actions.main+=/shadow_word_death,moving=1
actions.main+=/shadow_word_pain,moving=1,cycle_targets=1

actions.vent=mindbender,if=talent.mindbender.enabled&cooldown.mind_blast.remains>=gcd
actions.vent+=/shadowfiend,if=!talent.mindbender.enabled&cooldown.mind_blast.remains>=gcd
actions.vent+=/void_entropy,if=shadow_orb=3&!ticking&target.time_to_die>60&active_enemies=1
actions.vent+=/void_entropy,if=!dot.void_entropy.ticking&shadow_orb=5&active_enemies>=1&target.time_to_die>60,cycle_targets=1,max_cycle_targets=(60%(cooldown.mind_blast.duration*3*spell_haste))
actions.vent+=/devouring_plague,if=dot.void_entropy.ticking&dot.void_entropy.remains<=gcd*2&cooldown_react,cycle_targets=1
actions.vent+=/devouring_plague,if=shadow_orb=5&dot.void_entropy.remains<10,cycle_targets=1
actions.vent+=/devouring_plague,if=shadow_orb=5&dot.void_entropy.remains<20,cycle_targets=1
actions.vent+=/devouring_plague,if=shadow_orb=5&dot.void_entropy.remains,cycle_targets=1
actions.vent+=/halo,if=talent.halo.enabled&target.distance<=30&active_enemies>=4
actions.vent+=/mind_blast,if=glyph.mind_harvest.enabled&mind_harvest=0&shadow_orb<=2,cycle_targets=1
actions.vent+=/devouring_plague,if=glyph.mind_harvest.enabled&mind_harvest=0&shadow_orb>=3,cycle_targets=1
actions.vent+=/mind_blast,if=active_enemies<=10&cooldown_react&shadow_orb<=4
actions.vent+=/shadow_word_death,if=target.health.pct<20&cooldown_react&shadow_orb<=4,cycle_targets=1
actions.vent+=/shadow_word_pain,if=shadow_orb=4&remains<(18*0.50)&set_bonus.tier17_2pc&cooldown.mind_blast.remains<1.2*gcd&cooldown.mind_blast.remains>0.2*gcd
actions.vent+=/insanity,if=buff.shadow_word_insanity.remains<0.5*gcd&active_enemies<=3&cooldown.mind_blast.remains>0.5*gcd,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1)
actions.vent+=/insanity,chain=1,if=active_enemies<=3&cooldown.mind_blast.remains>0.5*gcd,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1)
actions.vent+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=3
actions.vent+=/shadow_word_pain,if=remains<(18*0.35)&miss_react,cycle_targets=1,max_cycle_targets=5
actions.vent+=/vampiric_touch,if=remains<(15*0.35)&miss_react,cycle_targets=1,max_cycle_targets=5
actions.vent+=/halo,if=talent.halo.enabled&target.distance<=30&cooldown.mind_blast.remains>0.5*gcd
actions.vent+=/cascade,if=talent.cascade.enabled&target.distance<=40&cooldown.mind_blast.remains>0.5*gcd
actions.vent+=/divine_star,if=talent.divine_star.enabled&active_enemies>4&target.distance<=24&cooldown.mind_blast.remains>0.5*gcd
actions.vent+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.up&cooldown_react&cooldown.mind_blast.remains>0.5*gcd
actions.vent+=/mind_sear,chain=1,if=active_enemies>=3&cooldown.mind_blast.remains>0.5*gcd,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1)
actions.vent+=/mind_flay,if=cooldown.mind_blast.remains>0.5*gcd,interrupt=1,chain=1
actions.vent+=/shadow_word_death,moving=1
actions.vent+=/mind_blast,moving=1,if=buff.shadowy_insight.react&cooldown_react
actions.vent+=/divine_star,moving=1,if=talent.divine_star.enabled&target.distance<=28
actions.vent+=/cascade,moving=1,if=talent.cascade.enabled&target.distance<=40
actions.vent+=/shadow_word_death,moving=1
actions.vent+=/shadow_word_pain,moving=1,cycle_targets=1

actions.cop_dotweave=devouring_plague,if=target.dot.vampiric_touch.ticking&target.dot.shadow_word_pain.ticking&shadow_orb=5&cooldown_react
actions.cop_dotweave+=/devouring_plague,if=(buff.mental_instinct.remains<gcd&buff.mental_instinct.remains)
actions.cop_dotweave+=/devouring_plague,if=(target.dot.vampiric_touch.ticking&target.dot.shadow_word_pain.ticking&!buff.shadow_word_insanity.remains&cooldown.mind_blast.remains>0.4*gcd)
actions.cop_dotweave+=/mind_blast,if=glyph.mind_harvest.enabled&mind_harvest=0&shadow_orb<=2,cycle_targets=1
actions.cop_dotweave+=/mind_blast,if=shadow_orb<=4&cooldown_react
actions.cop_dotweave+=/shadowfiend,if=!talent.mindbender.enabled&!buff.shadow_word_insanity.remains
actions.cop_dotweave+=/mindbender,if=talent.mindbender.enabled&!buff.shadow_word_insanity.remains
actions.cop_dotweave+=/shadow_word_pain,if=shadow_orb=4&set_bonus.tier17_2pc&!target.dot.shadow_word_pain.ticking&!target.dot.devouring_plague.ticking&cooldown.mind_blast.remains<1.2*gcd&cooldown.mind_blast.remains>0.2*gcd
actions.cop_dotweave+=/shadow_word_pain,if=shadow_orb=5&!target.dot.devouring_plague.ticking&!target.dot.shadow_word_pain.ticking
actions.cop_dotweave+=/vampiric_touch,if=shadow_orb=5&!target.dot.devouring_plague.ticking&!target.dot.vampiric_touch.ticking
actions.cop_dotweave+=/insanity,if=buff.shadow_word_insanity.remains,chain=1,interrupt_if=cooldown.mind_blast.remains<=0.1
actions.cop_dotweave+=/shadow_word_pain,if=shadow_orb>=2&target.dot.shadow_word_pain.remains>=6&cooldown.mind_blast.remains>0.5*gcd&target.dot.vampiric_touch.remains&buff.bloodlust.up&!set_bonus.tier17_2pc
actions.cop_dotweave+=/vampiric_touch,if=shadow_orb>=2&target.dot.vampiric_touch.remains>=5&cooldown.mind_blast.remains>0.5*gcd&buff.bloodlust.up&!set_bonus.tier17_2pc
actions.cop_dotweave+=/halo,if=cooldown.mind_blast.remains>0.5*gcd&talent.halo.enabled&target.distance<=30&target.distance>=17
actions.cop_dotweave+=/divine_star,if=cooldown.mind_blast.remains>0.5&gcd&talent.divine_star.enabled&(active_enemies>1|target.distance<=24)
actions.cop_dotweave+=/cascade,if=cooldown.mind_blast.remains>0.5*gcd&talent.cascade.enabled&((active_enemies>1|target.distance>=28)&target.distance<=40&target.distance>=11)
actions.cop_dotweave+=/shadow_word_pain,if=primary_target=0&(!ticking|remains<=18*0.3),cycle_targets=1,max_cycle_targets=5
actions.cop_dotweave+=/vampiric_touch,if=primary_target=0&(!ticking|remains<=15*0.3),cycle_targets=1,max_cycle_targets=5
actions.cop_dotweave+=/mind_spike,if=buff.shadow_word_insanity.remains<=gcd&buff.bloodlust.up&!target.dot.shadow_word_pain.remains&!target.dot.vampiric_touch.remains
actions.cop_dotweave+=/mind_spike,if=((target.dot.shadow_word_pain.remains&!target.dot.vampiric_touch.remains)|(!target.dot.shadow_word_pain.remains&target.dot.vampiric_touch.remains))&shadow_orb<=2&cooldown.mind_blast.remains>0.5*gcd
actions.cop_dotweave+=/mind_flay,if=set_bonus.tier17_2pc&target.dot.shadow_word_pain.remains&target.dot.vampiric_touch.remains&cooldown.mind_blast.remains>0.9*gcd,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1)
actions.cop_dotweave+=/mind_spike
actions.cop_dotweave+=/shadow_word_death,moving=1
actions.cop_dotweave+=/halo,if=talent.halo.enabled&target.distance<=30,moving=1
actions.cop_dotweave+=/divine_star,if=talent.divine_star.enabled&target.distance<=28,moving=1
actions.cop_dotweave+=/cascade,if=talent.cascade.enabled&target.distance<=40,moving=1
actions.cop_dotweave+=/shadow_word_pain,moving=1

actions.cop_mfi=devouring_plague,if=shadow_orb=5
actions.cop_mfi+=/mind_blast,if=glyph.mind_harvest.enabled&mind_harvest=0,cycle_targets=1
actions.cop_mfi+=/mind_blast,if=active_enemies<=5&cooldown_react
actions.cop_mfi+=/shadow_word_death,if=target.health.pct<20,cycle_targets=1
actions.cop_mfi+=/devouring_plague,if=shadow_orb>=3&(cooldown.mind_blast.remains<gcd*1.0|target.health.pct<20&cooldown.shadow_word_death.remains<gcd*1.0)
actions.cop_mfi+=/mindbender,if=talent.mindbender.enabled
actions.cop_mfi+=/shadowfiend,if=!talent.mindbender.enabled
actions.cop_mfi+=/shadow_word_pain,if=remains<(18*0.3)&miss_react&active_enemies<=5&primary_target=0,cycle_targets=1,max_cycle_targets=5
actions.cop_mfi+=/vampiric_touch,if=remains<(15*0.3+cast_time)&miss_react&active_enemies<=5&primary_target=0,cycle_targets=1,max_cycle_targets=5
actions.cop_mfi+=/insanity,if=buff.shadow_word_insanity.remains<0.5*gcd&active_enemies<=2,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|(cooldown.shadow_word_death.remains<=0.1*target.health.pct<20))
actions.cop_mfi+=/insanity,if=active_enemies<=2,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|(cooldown.shadow_word_death.remains<=0.1*target.health.pct<20))
actions.cop_mfi+=/halo,if=talent.halo.enabled&target.distance<=30&target.distance>=17
actions.cop_mfi+=/cascade,if=talent.cascade.enabled&((active_enemies>1|target.distance>=28)&target.distance<=40&target.distance>=11)
actions.cop_mfi+=/divine_star,if=talent.divine_star.enabled&(active_enemies>1|target.distance<=24)
actions.cop_mfi+=/mind_sear,if=active_enemies>=6,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1)
actions.cop_mfi+=/mind_spike
actions.cop_mfi+=/shadow_word_death,moving=1
actions.cop_mfi+=/mind_blast,if=buff.shadowy_insight.react&cooldown_react,moving=1
actions.cop_mfi+=/halo,if=talent.halo.enabled&target.distance<=30,moving=1
actions.cop_mfi+=/divine_star,if=talent.divine_star.enabled&target.distance<=28,moving=1
actions.cop_mfi+=/cascade,if=talent.cascade.enabled&target.distance<=40,moving=1
actions.cop_mfi+=/shadow_word_pain,if=primary_target=0,moving=1,cycle_targets=1

actions.cop=devouring_plague,if=shadow_orb>=3&(cooldown.mind_blast.remains<=gcd*1.0|(cooldown.shadow_word_death.remains<=gcd*1.0&target.health.pct<20))&primary_target=0,cycle_targets=1
actions.cop+=/devouring_plague,if=shadow_orb>=3&(cooldown.mind_blast.remains<=gcd*1.0|(cooldown.shadow_word_death.remains<=gcd*1.0&target.health.pct<20))
actions.cop+=/mind_blast,if=mind_harvest=0,cycle_targets=1
actions.cop+=/mind_blast,if=active_enemies<=5&cooldown_react
actions.cop+=/shadow_word_death,if=target.health.pct<20,cycle_targets=1
actions.cop+=/mindbender,if=talent.mindbender.enabled
actions.cop+=/shadowfiend,if=!talent.mindbender.enabled
actions.cop+=/halo,if=talent.halo.enabled&target.distance<=30&target.distance>=17
actions.cop+=/cascade,if=talent.cascade.enabled&((active_enemies>1|target.distance>=28)&target.distance<=40&target.distance>=11)
actions.cop+=/divine_star,if=talent.divine_star.enabled&(active_enemies>1|target.distance<=24)
actions.cop+=/shadow_word_pain,if=miss_react&!ticking&active_enemies<=5&primary_target=0,cycle_targets=1,max_cycle_targets=5
actions.cop+=/vampiric_touch,if=remains<cast_time&miss_react&active_enemies<=5&primary_target=0,cycle_targets=1,max_cycle_targets=5
actions.cop+=/mind_sear,if=active_enemies>=5,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1)
actions.cop+=/mind_spike,if=active_enemies<=4&buff.surge_of_darkness.react
actions.cop+=/mind_sear,if=active_enemies>=3,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1)
actions.cop+=/mind_flay,if=target.dot.devouring_plague_tick.ticks_remain>1&active_enemies=1,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1)
actions.cop+=/mind_spike
actions.cop+=/shadow_word_death,moving=1
actions.cop+=/mind_blast,if=buff.shadowy_insight.react&cooldown_react,moving=1
actions.cop+=/halo,moving=1,if=talent.halo.enabled&target.distance<=30
actions.cop+=/divine_star,if=talent.divine_star.enabled&target.distance<=28,moving=1
actions.cop+=/cascade,if=talent.cascade.enabled&target.distance<=40,moving=1
actions.cop+=/shadow_word_pain,if=primary_target=0,moving=1,cycle_targets=1

head=crown_of_power,id=118942
neck=braided_magnaron_plait,id=120084,enchant=40crit
shoulders=felflame_spaulders,id=109948,bonus_id=523/524,gems=35mastery
back=kyusys_tarflame_doomcloak,id=119346,bonus_id=560,enchant=100crit
chest=robes_of_volatile_ice,id=114500,bonus_id=81/563,gems=35crit
shirt=paper_shirt,id=98087
tabard=argent_crusaders_tabard,id=46874
wrists=bracers_of_volatile_ice,id=114493,bonus_id=220/560
hands=sterilized_handwraps,id=115998
waist=girdle_of_the_infected_mind,id=113656
legs=lightbinder_leggings,id=109807,bonus_id=523/524,gems=35mastery
feet=sandals_of_volatile_ice,id=114501,bonus_id=142/563,gems=35crit
finger1=timeless_solium_band_of_the_archmage,id=118296,enchant=30crit
finger2=darkflame_loop,id=109766,bonus_id=524,enchant=30crit
trinket1=grandiose_power,id=114550,bonus_id=42
trinket2=crushtos_runic_alarm,id=110000,bonus_id=524
main_hand=shard_of_crystalline_fury,id=116362,enchant=mark_of_the_shattered_hand
off_hand=bileslingers_censer,id=113592,bonus_id=566

# Gear Summary
# gear_stamina=2881
# gear_intellect=2263
# gear_spell_power=1054
# gear_crit_rating=1295
# gear_haste_rating=437
# gear_mastery_rating=582
# gear_armor=603
# gear_multistrike_rating=418
# gear_versatility_rating=443
# gear_speed_rating=82

Ralana

Ralana : 21812 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
21812.4 21812.4 7.9 / 0.036% 2488.5 / 11.4% 754.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
28.9 28.9 Energy 32.16% 45.0 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Ralana/advanced
Talents
  • 15: Shadow Focus
  • 30: Combat Readiness
  • 45: Elusiveness
  • 60: Shadowstep
  • 75: Prey on the Weak
  • 90: Anticipation
  • 100: Venom Rush
  • Talent Calculator
Glyphs
  • Glyph of Energy
  • Glyph of Feint
  • Glyph of Disappearance
  • Glyph of Poisons
  • Glyph of Safe Fall
  • Glyph of Decoy
Professions
  • engineering: 659
  • jewelcrafting: 659

Charts

http://3.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Ralana+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x240&chd=t:30444|20671|19329|10257|7715|4734|2328&chds=0,60888&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++30444++eviscerate,C79C6E,0,0,15|t++20671++killing_spree,C79C6E,1,0,15|t++19329++ambush,C79C6E,2,0,15|t++10257++sinister_strike,C79C6E,3,0,15|t++7715++revealing_strike,C79C6E,4,0,15|t++4734++auto_attack_mh,C79C6E,5,0,15|t++2328++auto_attack_oh,C79C6E,6,0,15& http://4.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Ralana+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:21,19,16,14,11,10,4,2,2,1&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ABD473,C79C6E,C79C6E,C79C6E,C79C6E&chl=auto_attack_mh|sinister_strike|eviscerate|main_gauche|auto_attack_oh|instant_poison|killing_spree_mh|ambush|killing_spree_oh|revealing_strike&
http://6.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Ralana+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:begjnqtx2668765445665431ywvrolkjhgedbZYXVVVWWXYYZabcdfghiijkkllkkjihgfedbaZZYYYYZZabcefhjmoqstvxyz011110zywvtqomkigfdbZYWVVUUUUUVVWWXYZZabccdddeeeeedddccbaaZZYYYYYYYYZZabccdfghijkllmnnnnnnmmlkjihgfedcbaZYXXWWWWWXXXYYYZaabcddefgghhhiiihhhggfeddcbaZZYXXXXXXXXYYZabcdefghijklmnnoooooonnmlkjihgfedcbaZZZYYYYYYYYYZZZZaaaaabbbbbbbaaaaaZZZZZZZZaaaabbccddeffghhiijjjjjihhgecaYXVTRPN&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.552154,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=21812|max=39504&chxp=1,1,55,100 http://9.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Ralana+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,0,0,1,7,16,26,29,69,154,211,312,426,609,818,946,1230,1365,1572,1665,1615,1757,1685,1601,1488,1410,1217,1041,835,705,584,420,338,248,188,150,93,63,29,36,10,10,10,4,2,1,0,2,0,1&chds=0,1757&chbh=5&chxt=x&chxl=0:|min=19376|avg=21812|max=24908&chxp=0,1,44,100& http://5.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Ralana+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:40.7,11.1,6.2,4.0,3.2,2.4,0.4,32.2&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ffffff&chl=sinister_strike 122.5s|eviscerate 33.5s|killing_spree 18.5s|revealing_strike 12.2s|slice_and_dice 9.5s|ambush 7.1s|preparation 1.2s|waiting 96.8s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Ralana 21812
ambush 458 2.1% 7.1 48.65sec 19416 19329 Direct 7.1 15105 30179 18525 22.7% 1.1 4532 9052 22.3%  

Stats details: ambush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.09 7.09 0.00 0.00 1.0045 0.0000 137741.55 211687.01 34.93 19329.43 19329.43
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.25 22.32% 9052.18 6832 12530 2047.55 0 12530 2307 3546 7.90
multistrike 0.89 77.68% 4531.66 3416 6265 2700.74 0 6265 4019 6177 20.81
hit 5.48 77.31% 15104.58 11386 20883 15132.67 0 20883 82844 127317 34.93
crit 1.61 22.69% 30178.66 22772 41767 25277.82 0 41767 48572 74647 29.20
 
DPS Timeline Chart
 

Action details: ambush

Static Values
  • id:8676
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8676
  • name:Ambush
  • school:physical
  • tooltip:
  • description:Ambush the target, causing $sw2 Physical damage to the target (damage increased 40% if a dagger is equipped){$?s138106=false}[ and causes you to appear behind the target][]. Awards {$s3=2} combo $lpoint:points;.{$?s91023=false}[ For the next {$91021d=10 seconds}, your attacks bypass up to {$91021s1=100}% of that enemy's armor.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.11
 
auto_attack_mh 4668 21.4% 215.8 1.40sec 6500 4734 Direct 215.8 5054 10107 6199 22.7% 35.1 1516 3032 22.6%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 215.80 215.80 0.00 0.00 1.3730 0.0000 1402832.90 2155932.67 34.93 4734.45 4734.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 7.93 22.63% 3032.03 2351 4322 3033.64 0 4322 24051 36962 34.92
multistrike 27.12 77.37% 1515.94 1175 2161 1516.73 1270 1847 41111 63180 34.93
hit 166.91 77.34% 5053.50 3918 7203 5056.57 4887 5272 843488 1296307 34.93
crit 48.89 22.66% 10107.40 7836 14406 10113.96 9186 11409 494184 759483 34.93
 
DPS Timeline Chart
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 2293 10.5% 212.1 1.42sec 3248 2328 Direct 212.1 2524 5049 3097 22.7% 34.4 757 1514 22.6%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 212.12 212.12 0.00 0.00 1.3953 0.0000 688874.68 1058691.62 34.93 2327.52 2327.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 7.79 22.64% 1513.84 1175 2161 1514.02 0 2161 11796 18128 34.92
multistrike 26.62 77.36% 757.23 588 1080 757.72 653 896 20157 30978 34.93
hit 164.00 77.31% 2524.22 1959 3602 2525.74 2430 2639 413963 636196 34.93
crit 48.12 22.69% 5048.86 3918 7203 5052.17 4515 5588 242959 373390 34.93
 
DPS Timeline Chart
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
eviscerate 3395 15.6% 35.8 8.02sec 28481 30444 Direct 35.8 22148 44304 27158 22.6% 5.8 6646 13282 22.7%  

Stats details: eviscerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.81 35.81 0.00 0.00 0.9355 0.0000 1019906.38 1567435.07 34.93 30444.06 30444.06
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.32 22.66% 13282.07 9137 17378 9704.56 0 17378 17497 26890 25.52
multistrike 4.50 77.34% 6645.97 4569 8689 6570.04 0 8689 29880 45920 34.50
hit 27.71 77.39% 22148.47 15229 28963 22171.99 19951 24270 613803 943318 34.93
crit 8.10 22.61% 44304.35 30458 57925 44342.99 0 57925 358727 551307 34.93
 
DPS Timeline Chart
 

Action details: eviscerate

Static Values
  • id:2098
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2098
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that causes damage per combo point: 1 point : ${($AP*0.577)*$<mult>} damage 2 points: ${($AP*0.577)*$<mult>*2} damage 3 points: ${($AP*0.577)*$<mult>*3} damage 4 points: ${($AP*0.577)*$<mult>*4} damage 5 points: ${($AP*0.577)*$<mult>*5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.507760
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00
 
instant_poison 2106 9.7% 208.0 1.47sec 3041 0 Direct 208.0 2364 4728 2900 22.6% 33.8 709 1419 22.5%  

Stats details: instant_poison

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 207.99 207.99 0.00 0.00 0.0000 0.0000 632510.89 632510.89 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 7.62 22.54% 1418.90 1082 2058 1418.38 0 2058 10813 10813 0.00
multistrike 26.18 77.46% 709.33 541 1029 709.91 604 862 18573 18573 0.00
hit 160.89 77.35% 2364.33 1804 3430 2366.08 2222 2527 380392 380392 0.00
crit 47.10 22.65% 4728.43 3608 6860 4731.87 4195 5340 222733 222733 0.00
 
DPS Timeline Chart
 

Action details: instant_poison

Static Values
  • id:157607
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:157607
  • name:Instant Poison
  • school:nature
  • tooltip:
  • description:{$@spelldesc157584=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance of instantly poisoning the enemy for {$157607s1=0 to 2} Nature damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.264000
  • spell_power_mod.direct:0.000000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
killing_spree 0 (1276) 0.0% (5.8%) 5.7 57.11sec 66873 20671

Stats details: killing_spree

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.72 5.72 39.89 39.89 3.2351 0.4282 0.00 0.00 0.00 20671.21 20671.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.72 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.9 77.38% 0.00 0 0 0.00 0 0 0 0 0.00
crit 9.0 22.62% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: killing_spree

Static Values
  • id:51690
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:time_to_die>=44
Spelldata
  • id:51690
  • name:Killing Spree
  • school:physical
  • tooltip:Attacking an enemy every $t1 sec. Damage dealt increased by $61851s3%.
  • description:Step through the shadows to a visible enemy within 10 yards, attacking 7 times over {$d=3 seconds} for $57841sw3 Physical damage with your main-hand and $57842sw3 Physical damage with your off-hand. While Blade Flurry is active, each Killing Spree attack will teleport to and damage a different nearby enemy target. The Rogue cannot be targeted or disabled while Killing Spree is active.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
 
    killing_spree_mh 851 3.9% 39.9 7.02sec 6398 0 Periodic 39.9 4851 9702 5954 22.7% 6.5 2239 4476 22.5% 0.0%

Stats details: killing_spree_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.89 0.00 0.00 39.89 0.0000 0.0000 255231.14 382729.34 33.31 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.5 22.48% 4475.70 3379 6197 3431.25 0 6197 6509 6509 0.00
multistrike 5.0 77.52% 2238.58 1689 3098 2224.14 0 3098 11225 11225 0.00
hit 30.8 77.28% 4851.17 3664 6720 4853.82 4163 5684 149543 229824 34.93
crit 9.1 22.72% 9702.19 7328 13441 9709.56 0 13441 87954 135171 34.93
 
DPS Timeline Chart
 

Action details: killing_spree_mh

Static Values
  • id:57841
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57841
  • name:Killing Spree
  • school:physical
  • tooltip:
  • description:{$@spelldesc51690=Step through the shadows to a visible enemy within 10 yards, attacking 7 times over {$d=3 seconds} for $57841sw3 Physical damage with your main-hand and $57842sw3 Physical damage with your off-hand. While Blade Flurry is active, each Killing Spree attack will teleport to and damage a different nearby enemy target. The Rogue cannot be targeted or disabled while Killing Spree is active.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    killing_spree_oh 425 1.9% 39.9 7.02sec 3199 0 Periodic 39.9 2425 4852 2976 22.7% 6.5 1119 2237 22.7% 0.0%

Stats details: killing_spree_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.89 0.00 0.00 39.89 0.0000 0.0000 127599.73 191335.98 33.31 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.5 22.69% 2237.17 1689 3098 1729.97 0 3098 3282 3282 0.00
multistrike 5.0 77.31% 1118.99 845 1549 1112.35 0 1549 5594 5594 0.00
hit 30.8 77.30% 2425.50 1832 3360 2426.95 2064 2876 74795 114949 34.93
crit 9.1 22.70% 4851.71 3664 6720 4854.03 0 6720 43929 67512 34.93
 
DPS Timeline Chart
 

Action details: killing_spree_oh

Static Values
  • id:57842
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57842
  • name:Killing Spree Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc51690=Step through the shadows to a visible enemy within 10 yards, attacking 7 times over {$d=3 seconds} for $57841sw3 Physical damage with your main-hand and $57842sw3 Physical damage with your off-hand. While Blade Flurry is active, each Killing Spree attack will teleport to and damage a different nearby enemy target. The Rogue cannot be targeted or disabled while Killing Spree is active.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
main_gauche 3123 14.3% 214.7 1.47sec 4368 0 Direct 214.7 3396 6793 4165 22.6% 34.8 1019 2037 22.7%  

Stats details: main_gauche

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 214.74 214.74 0.00 0.00 0.0000 0.0000 937901.26 1441406.15 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 7.92 22.72% 2037.33 1539 2823 2037.44 0 2823 16133 24794 34.91
multistrike 26.93 77.28% 1018.76 769 1411 1019.21 866 1215 27433 42161 34.93
hit 166.16 77.38% 3396.43 2565 4704 3398.15 3197 3606 564356 867326 34.93
crit 48.58 22.62% 6792.55 5130 9408 6796.38 6086 7585 329979 507126 34.93
 
DPS Timeline Chart
 

Action details: main_gauche

Static Values
  • id:86392
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:86392
  • name:Main Gauche
  • school:physical
  • tooltip:
  • description:A vicious attack that deals $86392sw2 Physical damage with your off-hand.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.40
 
revealing_strike 312 1.4% 12.7 24.25sec 7391 7715 Direct 12.7 5737 11478 7045 22.8% 2.1 1722 3438 22.4%  

Stats details: revealing_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.69 12.69 96.47 96.47 0.9580 3.0000 93826.09 1194005.95 92.14 311.13 7715.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.47 22.44% 3437.62 2638 4839 1294.67 0 4839 1605 2467 13.16
multistrike 1.61 77.56% 1722.39 1319 2419 1387.60 0 2419 2780 4272 28.15
hit 9.80 77.22% 5737.45 4397 8064 5740.32 4707 6658 56241 86434 34.93
crit 2.89 22.78% 11478.19 8794 16129 11032.56 0 16129 33200 51023 33.56
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.6 77.34% 0.00 0 0 0.00 0 0 0 811958 100.00
crit 21.9 22.66% 0.00 0 0 0.00 0 0 0 237852 100.00
 
DPS Timeline Chart
 

Action details: revealing_strike

Static Values
  • id:84617
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(combo_points=4&dot.revealing_strike.remains<7.2&(target.time_to_die>dot.revealing_strike.remains+7.2)|(target.time_to_die<dot.revealing_strike.remains+7.2&ticks_remain<2))|!ticking
Spelldata
  • id:84617
  • name:Revealing Strike
  • school:physical
  • tooltip:Reveals weakness, increasing the effectiveness of the Rogue's offensive finishing moves by $w3%, and giving the Rogue's Sinister Strikes a {$h=0}% chance to generate an extra combo point.
  • description:Deals $sw1 Physical damage, increasing the effect of your offensive finishing moves on that target by {$s3=35}%, and giving your Sinister Strike a {$s6=25}% chance to generate an extra combo point. Lasts {$d=24 seconds}. Awards {$s2=1} combo $lpoint:points;.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.20
 
sinister_strike 4182 19.2% 130.1 2.27sec 9654 10257 Direct 130.1 7505 15012 9206 22.7% 21.1 2251 4503 22.6%  

Stats details: sinister_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 130.15 130.15 0.00 0.00 0.9411 0.0000 1256391.94 1930876.03 34.93 10257.18 10257.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 4.78 22.65% 4503.16 3517 6452 4465.01 0 6452 21518 33069 34.60
multistrike 16.32 77.35% 2250.92 1759 3226 2252.39 1834 2790 36739 56461 34.93
hit 100.66 77.34% 7505.00 5862 10753 7509.94 7163 7917 755446 1161001 34.93
crit 29.49 22.66% 15011.66 11725 21505 15022.78 13242 17127 442690 680344 34.93
 
DPS Timeline Chart
 

Action details: sinister_strike

Static Values
  • id:1752
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:50.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.revealing_strike.ticking
Spelldata
  • id:1752
  • name:Sinister Strike
  • school:physical
  • tooltip:
  • description:An instant strike that causes $sw3 Physical damage.{$?s79327=false}[ Awards {$s2=0} combo $lpoint:points;.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.60
 
Simple Action Stats Execute Interval
Ralana
adrenaline_rush 3.9 86.39sec

Stats details: adrenaline_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.88 3.88 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 3.88 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: adrenaline_rush

Static Values
  • id:13750
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:time_to_die>=44
Spelldata
  • id:13750
  • name:Adrenaline Rush
  • school:physical
  • tooltip:Energy regeneration increased by {$s1=100}%. Attack speed increased by {$s2=20}%.$?$w3!=0[ Global cooldown of Sinister Strike, Revealing Strike, Eviscerate, Slice and Dice, and Rupture reduced by ${$m3/-1000}.1 sec.][]
  • description:Increases your Energy regeneration rate by {$s1=100}% and your attack speed by {$s2=20}% for {$d=15 seconds}. While Adrenaline Rush is active, the global cooldown on most of your Energy consumers is reduced by ${$m3/-1000}.1 sec
 
draenic_agility_potion 2.0 0.00sec

Stats details: draenic_agility_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156423
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156423
  • name:Draenic Agility Potion
  • school:physical
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
 
kick 8.3 37.80sec

Stats details: kick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.30 8.30 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: kick

Static Values
  • id:1766
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:1766
  • name:Kick
  • school:physical
  • tooltip:
  • description:A quick kick that interrupts spellcasting and prevents any spell in that school from being cast for {$d=5 seconds}.{$?s56805=false}[ If you successfully interrupt a spell, Kick's cooldown is reduced by ${$56805m2/1000} sec.][]
 
preparation 1.2 313.12sec

Stats details: preparation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.22 1.22 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 1.22 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: preparation

Static Values
  • id:14185
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.vanish.up&cooldown.vanish.remains>30
Spelldata
  • id:14185
  • name:Preparation
  • school:physical
  • tooltip:
  • description:Immediately resets the cooldown on your Sprint, Vanish, and Evasion.
 
slice_and_dice 9.8 32.11sec

Stats details: slice_and_dice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.80 9.80 0.00 0.00 0.9673 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 9.80 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: slice_and_dice

Static Values
  • id:5171
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.marked_for_death.enabled
Spelldata
  • id:5171
  • name:Slice and Dice
  • school:physical
  • tooltip:Attack speed increased by $w1%.$?$w2!=0[ Regaining $w2 Energy every $t2 sec.][]
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=40}%{$?s79152=false}[ and grant {$79152s1=8} Energy per $5171t2 sec][]. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds
 
vanish 6.1 48.64sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.10 6.10 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 6.10 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:time>10&(combo_points<3|(talent.anticipation.enabled&anticipation_charges<3)|(combo_points<4|(talent.anticipation.enabled&anticipation_charges<4)))&((talent.shadow_focus.enabled&buff.adrenaline_rush.down&energy<90&energy>=15)|(talent.subterfuge.enabled&energy>=90)|(!talent.shadow_focus.enabled&!talent.subterfuge.enabled&energy>=60))
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering an improved stealth mode for {$11327d=3 seconds}. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
adrenaline_rush 3.9 0.0 86.4sec 86.4sec 18.86% 19.33% 0.0(0.0)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_adrenaline_rush
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • adrenaline_rush_1:18.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:13750
  • name:Adrenaline Rush
  • tooltip:Energy regeneration increased by {$s1=100}%. Attack speed increased by {$s2=20}%.$?$w3!=0[ Global cooldown of Sinister Strike, Revealing Strike, Eviscerate, Slice and Dice, and Rupture reduced by ${$m3/-1000}.1 sec.][]
  • description:Increases your Energy regeneration rate by {$s1=100}% and your attack speed by {$s2=20}% for {$d=15 seconds}. While Adrenaline Rush is active, the global cooldown on most of your Energy consumers is reduced by ${$m3/-1000}.1 sec
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
anticipation 23.7 55.4 12.4sec 3.6sec 46.41% 46.42% 0.0(0.0)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_anticipation
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • anticipation_1:14.26%
  • anticipation_2:11.96%
  • anticipation_3:10.17%
  • anticipation_4:7.15%
  • anticipation_5:2.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:115189
  • name:Anticipation
  • tooltip:Your next offensive finishing move will grant you {$s1=1} combo points on that target.
  • description:{$@spelldesc114015=When one of your attacks generates a combo point while you already have 5 combo points, you gain an Anticipation charge. Performing an offensive finishing move consumes all Anticipation charges and grants you a combo point for each.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
bandits_guile 7.8 81.8 40.2sec 3.3sec 94.95% 94.95% 0.0(0.0)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_bandits_guile
  • max_stacks:12
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bandits_guile_1:5.52%
  • bandits_guile_2:5.62%
  • bandits_guile_3:5.75%
  • bandits_guile_4:5.60%
  • bandits_guile_5:5.55%
  • bandits_guile_6:5.50%
  • bandits_guile_7:5.40%
  • bandits_guile_8:5.44%
  • bandits_guile_9:5.46%
  • bandits_guile_10:5.30%
  • bandits_guile_11:4.94%
  • bandits_guile_12:34.87%

Trigger Attempt Success

  • trigger_pct:68.82%

Spelldata details

  • id:84654
  • name:Bandit's Guile
  • tooltip:
  • description:Take advantage of the natural ebb and flow of combat, causing your Sinister Strike to gradually increase your damage dealt by up to {$84747s1=30}%. This maximum effect will last for {$84747d=15 seconds} before fading and beginning the cycle anew.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 20.35% 0.0(0.0)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
deep_insight 7.2 0.0 42.6sec 42.6sec 34.87% 10.59% 0.0(0.0)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_deep_insight
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • deep_insight_1:34.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:84747
  • name:Deep Insight
  • tooltip:Damage dealt increased by $w1%.
  • description:{$@spelldesc84654=Take advantage of the natural ebb and flow of combat, causing your Sinister Strike to gradually increase your damage dealt by up to {$84747s1=30}%. This maximum effect will last for {$84747d=15 seconds} before fading and beginning the cycle anew.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
draenic_agility_potion 2.0 0.0 86.5sec 0.0sec 15.21% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_draenic_agility_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:1000.00

Stack Uptimes

  • draenic_agility_potion_1:15.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156423
  • name:Draenic Agility Potion
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
exquisite_proficiency 4.9 0.0 68.2sec 68.2sec 31.41% 31.42% 0.0(0.0)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_exquisite_proficiency
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:mastery_rating
  • amount:581.00

Stack Uptimes

  • exquisite_proficiency_1:31.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:133630
  • name:Exquisite Proficiency
  • tooltip:Increases Mastery rating by {$s1=609}.
  • description:Increases Mastery rating by {$s1=609} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
killing_spree 2.2 0.0 168.4sec 168.4sec 2.20% 2.20% 13.2(13.2)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_killing_spree
  • max_stacks:1
  • duration:3.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • killing_spree_1:2.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:51690
  • name:Killing Spree
  • tooltip:Attacking an enemy every $t1 sec. Damage dealt increased by $61851s3%.
  • description:Step through the shadows to a visible enemy within 10 yards, attacking 7 times over {$d=3 seconds} for $57841sw3 Physical damage with your main-hand and $57842sw3 Physical damage with your off-hand. While Blade Flurry is active, each Killing Spree attack will teleport to and damage a different nearby enemy target. The Rogue cannot be targeted or disabled while Killing Spree is active.
  • max_stacks:0
  • duration:3.00
  • cooldown:120.00
  • default_chance:0.00%
mark_of_warsong 5.0 2.2 63.3sec 40.9sec 39.07% 39.08% 2.2(12.9)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_mark_of_warsong
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stat Buff details

  • stat:haste_rating
  • amount:100.00

Stack Uptimes

  • mark_of_warsong_1:3.16%
  • mark_of_warsong_2:3.31%
  • mark_of_warsong_3:3.46%
  • mark_of_warsong_4:3.62%
  • mark_of_warsong_5:3.79%
  • mark_of_warsong_6:3.97%
  • mark_of_warsong_7:4.15%
  • mark_of_warsong_8:4.33%
  • mark_of_warsong_9:4.53%
  • mark_of_warsong_10:4.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:159675
  • name:Mark of Warsong
  • tooltip:Haste increased by $w1.
  • description:Haste increased by {$s1=100}.
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
mark_of_warsong_oh (_oh) 5.0 2.2 63.2sec 40.8sec 39.11% 39.12% 2.2(12.9)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_mark_of_warsong_oh
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stat Buff details

  • stat:haste_rating
  • amount:100.00

Stack Uptimes

  • mark_of_warsong_oh_1:3.17%
  • mark_of_warsong_oh_2:3.31%
  • mark_of_warsong_oh_3:3.47%
  • mark_of_warsong_oh_4:3.63%
  • mark_of_warsong_oh_5:3.80%
  • mark_of_warsong_oh_6:3.97%
  • mark_of_warsong_oh_7:4.15%
  • mark_of_warsong_oh_8:4.34%
  • mark_of_warsong_oh_9:4.54%
  • mark_of_warsong_oh_10:4.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:159675
  • name:Mark of Warsong
  • tooltip:Haste increased by $w1.
  • description:Haste increased by {$s1=100}.
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
moderate_insight 7.4 21.8 41.8sec 9.7sec 21.14% 37.75% 21.8(21.8)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_moderate_insight
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • moderate_insight_1:21.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:84746
  • name:Moderate Insight
  • tooltip:Damage dealt increased by $s2%.
  • description:{$@spelldesc84654=Take advantage of the natural ebb and flow of combat, causing your Sinister Strike to gradually increase your damage dealt by up to {$84747s1=30}%. This maximum effect will last for {$84747d=15 seconds} before fading and beginning the cycle anew.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
shallow_insight 7.6 22.4 40.8sec 9.5sec 22.05% 39.20% 22.4(22.4)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_shallow_insight
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • shallow_insight_1:22.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:84745
  • name:Shallow Insight
  • tooltip:Damage dealt increased by {$s1=10}%.
  • description:{$@spelldesc84654=Take advantage of the natural ebb and flow of combat, causing your Sinister Strike to gradually increase your damage dealt by up to {$84747s1=30}%. This maximum effect will last for {$84747d=15 seconds} before fading and beginning the cycle anew.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
slice_and_dice 1.1 8.7 246.8sec 32.1sec 99.64% 100.00% 8.7(8.7)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • slice_and_dice_1:99.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5171
  • name:Slice and Dice
  • tooltip:Attack speed increased by $w1%.$?$w2!=0[ Regaining $w2 Energy every $t2 sec.][]
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=40}%{$?s79152=false}[ and grant {$79152s1=8} Energy per $5171t2 sec][]. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
stealth 6.2 0.0 52.2sec 59.5sec 0.00% 0.02% 0.0(0.0)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:0.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}%. ]?s13975[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%. ][]{$?s31223=false}[Attacks from Stealth and for {$31666d=6 seconds} after deal {$31223s1=10}% more damage. ][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:6.00
  • default_chance:100.00%
turbulent_vial_of_toxin 3.8 0.0 90.4sec 90.5sec 18.31% 18.33% 0.0(0.0)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_turbulent_vial_of_toxin
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stat Buff details

  • stat:mastery_rating
  • amount:1120.00

Stack Uptimes

  • turbulent_vial_of_toxin_1:18.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:176883
  • name:Turbulent Vial of Toxin
  • tooltip:Mastery increased by {$s1=870}.
  • description:Grants {$s1=870} Mastery for {$d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
vanish 6.1 0.0 48.7sec 48.7sec 0.00% 0.02% 0.0(0.0)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_agility_flask

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_greater_draenic_agility_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:250.00

Stack Uptimes

  • greater_draenic_agility_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156064
  • name:Greater Draenic Agility Flask
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Ralana
ambush Energy 7.1 201.6 28.4 28.4 683.3
eviscerate Energy 35.8 1253.3 35.0 35.0 813.7
eviscerate Combo Points 35.8 179.0 5.0 5.0 5696.2
revealing_strike Energy 12.7 507.8 40.0 40.0 184.8
sinister_strike Energy 130.1 6507.5 50.0 50.0 193.1
slice_and_dice Energy 9.8 245.1 25.0 25.0 0.0
slice_and_dice Combo Points 9.8 43.8 4.5 4.5 0.0
Resource Gains Type Count Total Average Overflow
ambush Combo Points 8.20 14.19 (6.08%) 1.73 0.00 0.00%
revealing_strike Combo Points 12.55 12.55 (5.38%) 1.00 0.00 0.00%
sinister_strike Combo Points 162.20 162.20 (69.46%) 1.00 0.00 0.00%
energy_regen Energy 1129.37 4612.46 (53.74%) 4.08 165.79 3.47%
external_healing Health 48.06 0.00 (0.00%) 0.00 325663.30 100.00%
leech Health 1297.37 0.00 (0.00%) 0.00 14058.77 100.00%
adrenaline_rush Energy 189.15 918.05 (10.70%) 4.85 24.60 2.61%
combat_potency Energy 136.67 1937.74 (22.58%) 14.18 112.27 5.48%
ruthlessness Energy 44.56 1113.97 (12.98%) 25.00 0.00 0.00%
ruthlessness Combo Points 44.56 44.56 (19.08%) 1.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Energy 28.52 28.87
Combo Points 0.75 0.74
Combat End Resource Mean Min Max
Energy 29.38 0.00 135.00
Combo Points 3.99 0.00 5.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 1.6%
shadow_reflection-Energy Cap 1.6%

Procs

Count Interval
Anticipation Charges (wasted) 6.0 46.5sec

Statistics & Data Analysis

Fight Length
Sample Data Ralana Fight Length
Count 25000
Mean 300.94
Minimum 230.43
Maximum 374.11
Spread ( max - min ) 143.68
Range [ ( max - min ) / 2 * 100% ] 23.87%
DPS
Sample Data Ralana Damage Per Second
Count 25000
Mean 21812.40
Minimum 19375.59
Maximum 24907.87
Spread ( max - min ) 5532.28
Range [ ( max - min ) / 2 * 100% ] 12.68%
Standard Deviation 634.6169
5th Percentile 20813.83
95th Percentile 22897.33
( 95th Percentile - 5th Percentile ) 2083.50
Mean Distribution
Standard Deviation 4.0137
95.00% Confidence Intervall ( 21804.53 - 21820.27 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 32
0.1% Error 3251
0.1 Scale Factor Error with Delta=300 3438
0.05 Scale Factor Error with Delta=300 13752
0.01 Scale Factor Error with Delta=300 343800
Distribution Chart
DPS(e)
Sample Data Ralana Damage Per Second (Effective)
Count 25000
Mean 21812.40
Minimum 19375.59
Maximum 24907.87
Spread ( max - min ) 5532.28
Range [ ( max - min ) / 2 * 100% ] 12.68%
Damage
Sample Data Ralana Damage
Count 25000
Mean 6552816.56
Minimum 4798192.73
Maximum 8452628.07
Spread ( max - min ) 3654435.34
Range [ ( max - min ) / 2 * 100% ] 27.88%
DTPS
Sample Data Ralana Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Ralana Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Ralana Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Ralana Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Ralana Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Ralana Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data RalanaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Ralana Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_agility_flask
1 0.00 food,type=frosty_stew
2 0.00 apply_poison,lethal=deadly
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=draenic_agility
5 0.00 stealth
6 0.00 marked_for_death
7 0.00 slice_and_dice,if=talent.marked_for_death.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,name=draenic_agility,if=buff.bloodlust.react|target.time_to_die<40|(buff.adrenaline_rush.up&(trinket.proc.any.react|trinket.stacking_proc.any.react|buff.archmages_greater_incandescence_agi.react))
9 8.30 kick
A 1.22 preparation,if=!buff.vanish.up&cooldown.vanish.remains>30
B 3.77 use_item,slot=trinket1
C 0.00 blood_fury
D 0.00 berserking
E 0.00 arcane_torrent,if=energy<60
F 0.00 blade_flurry,if=(active_enemies>=2&!buff.blade_flurry.up)|(active_enemies<2&buff.blade_flurry.up)
G 0.00 shadow_reflection,if=(cooldown.killing_spree.remains<10&combo_points>3)|buff.adrenaline_rush.up
H 7.09 ambush
I 6.10 vanish,if=time>10&(combo_points<3|(talent.anticipation.enabled&anticipation_charges<3)|(combo_points<4|(talent.anticipation.enabled&anticipation_charges<4)))&((talent.shadow_focus.enabled&buff.adrenaline_rush.down&energy<90&energy>=15)|(talent.subterfuge.enabled&energy>=90)|(!talent.shadow_focus.enabled&!talent.subterfuge.enabled&energy>=60))
J 9.80 slice_and_dice,if=buff.slice_and_dice.remains<2|((target.time_to_die>45&combo_points=5&buff.slice_and_dice.remains<12)&buff.deep_insight.down)
K 0.00 call_action_list,name=adrenaline_rush,if=(energy<35|buff.bloodlust.up)&cooldown.killing_spree.remains>10
L 0.00 call_action_list,name=killing_spree,if=(energy<40|(buff.bloodlust.up&time<10)|buff.bloodlust.remains>20)&buff.adrenaline_rush.down&(!talent.shadow_reflection.enabled|cooldown.shadow_reflection.remains>30|buff.shadow_reflection.remains>3)
M 0.00 marked_for_death,if=combo_points<=1&dot.revealing_strike.ticking&(!talent.shadow_reflection.enabled|buff.shadow_reflection.up|cooldown.shadow_reflection.remains>30)
N 0.00 call_action_list,name=generator,if=combo_points<5|!dot.revealing_strike.ticking|(talent.anticipation.enabled&anticipation_charges<=4&buff.deep_insight.down)
O 0.00 call_action_list,name=finisher,if=combo_points=5&dot.revealing_strike.ticking&(buff.deep_insight.up|!talent.anticipation.enabled|(talent.anticipation.enabled&anticipation_charges>=4))
actions.adrenaline_rush
# count action,conditions
P 3.83 adrenaline_rush,if=time_to_die>=44
Q 0.04 adrenaline_rush,if=time_to_die<44&(buff.archmages_greater_incandescence_agi.react|trinket.proc.any.react|trinket.stacking_proc.any.react)
R 0.02 adrenaline_rush,if=time_to_die<=buff.adrenaline_rush.duration*1.5
actions.killing_spree
# count action,conditions
S 5.66 killing_spree,if=time_to_die>=44
T 0.00 killing_spree,if=time_to_die<44&buff.archmages_greater_incandescence_agi.react&buff.archmages_greater_incandescence_agi.remains>=buff.killing_spree.duration
U 0.03 killing_spree,if=time_to_die<44&trinket.proc.any.react&trinket.proc.any.remains>=buff.killing_spree.duration
V 0.00 killing_spree,if=time_to_die<44&trinket.stacking_proc.any.react&trinket.stacking_proc.any.remains>=buff.killing_spree.duration
W 0.03 killing_spree,if=time_to_die<=buff.killing_spree.duration*1.5
actions.generator Combo point generators
# count action,conditions
X 12.69 revealing_strike,if=(combo_points=4&dot.revealing_strike.remains<7.2&(target.time_to_die>dot.revealing_strike.remains+7.2)|(target.time_to_die<dot.revealing_strike.remains+7.2&ticks_remain<2))|!ticking
Y 130.15 sinister_strike,if=dot.revealing_strike.ticking
actions.finisher Combo point finishers
# count action,conditions
Z 0.00 death_from_above
a 35.81 eviscerate

Sample Sequence

01245BHJS9PXYYYYJYYYYYYYaYaYYaYIHAaYYYIHaXYYYYYaYY9YJYYXaYSYYaaYYYYaYYYX9JYYYP8YYBYYaYYYaXaYYIHaYSYYaYYY9YJYYXYYYaYYYaXaYYYaY9YYYIHJYYYXYYSaYBYYYPaYaYYYa9YYaYYJYYXaYYYYYYJYYIHXaYS9YYYaaYYXaYYYYJYYYYaYPYY9YaYYBXaYaYaYYYaYYIHaYYSYYYaXYJ

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 135.0/135: 100% energy | 0.0/5: 0% combo_points
Pre food Fluffy_Pillow 135.0/135: 100% energy | 0.0/5: 0% combo_points
Pre apply_poison Fluffy_Pillow 135.0/135: 100% energy | 0.0/5: 0% combo_points
Pre potion Fluffy_Pillow 135.0/135: 100% energy | 0.0/5: 0% combo_points draenic_agility_potion
Pre stealth Fluffy_Pillow 135.0/135: 100% energy | 0.0/5: 0% combo_points draenic_agility_potion
0:00.000 use_item_turbulent_vial_of_toxin Fluffy_Pillow 135.0/135: 100% energy | 0.0/5: 0% combo_points draenic_agility_potion
0:00.000 ambush Fluffy_Pillow 135.0/135: 100% energy | 0.0/5: 0% combo_points draenic_agility_potion, turbulent_vial_of_toxin
0:01.003 slice_and_dice Fluffy_Pillow 135.0/135: 100% energy | 2.0/5: 40% combo_points bloodlust, mark_of_warsong_oh(10), draenic_agility_potion, turbulent_vial_of_toxin
0:02.005 killing_spree Fluffy_Pillow 131.2/135: 97% energy | 0.0/5: 0% combo_points bloodlust, slice_and_dice, mark_of_warsong(10), mark_of_warsong_oh(9), draenic_agility_potion, turbulent_vial_of_toxin
0:05.291 kick Fluffy_Pillow 135.0/135: 100% energy | 0.0/5: 0% combo_points bloodlust, slice_and_dice, exquisite_proficiency, mark_of_warsong(9), mark_of_warsong_oh(10), draenic_agility_potion, turbulent_vial_of_toxin
0:05.291 adrenaline_rush Fluffy_Pillow 135.0/135: 100% energy | 0.0/5: 0% combo_points bloodlust, slice_and_dice, exquisite_proficiency, mark_of_warsong(9), mark_of_warsong_oh(10), draenic_agility_potion, turbulent_vial_of_toxin
0:05.291 revealing_strike Fluffy_Pillow 135.0/135: 100% energy | 0.0/5: 0% combo_points bloodlust, adrenaline_rush, slice_and_dice, exquisite_proficiency, mark_of_warsong(9), mark_of_warsong_oh(10), draenic_agility_potion, turbulent_vial_of_toxin
0:06.096 sinister_strike Fluffy_Pillow 130.9/135: 97% energy | 1.0/5: 20% combo_points bloodlust, adrenaline_rush, slice_and_dice, exquisite_proficiency, mark_of_warsong(8), mark_of_warsong_oh(9), draenic_agility_potion, turbulent_vial_of_toxin
0:06.900 sinister_strike Fluffy_Pillow 116.4/135: 86% energy | 2.0/5: 40% combo_points bloodlust, bandits_guile, adrenaline_rush, slice_and_dice, exquisite_proficiency, mark_of_warsong(8), mark_of_warsong_oh(9), draenic_agility_potion, turbulent_vial_of_toxin
0:07.703 sinister_strike Fluffy_Pillow 101.8/135: 75% energy | 3.0/5: 60% combo_points bloodlust, bandits_guile(2), adrenaline_rush, slice_and_dice, exquisite_proficiency, mark_of_warsong(8), mark_of_warsong_oh(8), draenic_agility_potion, turbulent_vial_of_toxin
0:08.508 sinister_strike Fluffy_Pillow 101.9/135: 75% energy | 4.0/5: 80% combo_points bloodlust, bandits_guile(3), adrenaline_rush, slice_and_dice, exquisite_proficiency, mark_of_warsong(7), mark_of_warsong_oh(8), draenic_agility_potion, turbulent_vial_of_toxin
0:09.313 slice_and_dice Fluffy_Pillow 101.9/135: 75% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(4), adrenaline_rush, shallow_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(7), mark_of_warsong_oh(8), draenic_agility_potion, turbulent_vial_of_toxin
0:10.118 sinister_strike Fluffy_Pillow 135.0/135: 100% energy | 1.0/5: 20% combo_points bloodlust, bandits_guile(4), adrenaline_rush, shallow_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(6), mark_of_warsong_oh(7), draenic_agility_potion, turbulent_vial_of_toxin
0:10.921 sinister_strike Fluffy_Pillow 134.5/135: 100% energy | 2.0/5: 40% combo_points bloodlust, bandits_guile(5), adrenaline_rush, shallow_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(6), mark_of_warsong_oh(10), draenic_agility_potion, turbulent_vial_of_toxin
0:11.726 sinister_strike Fluffy_Pillow 134.8/135: 100% energy | 3.0/5: 60% combo_points bloodlust, bandits_guile(6), adrenaline_rush, shallow_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(6), mark_of_warsong_oh(10), draenic_agility_potion, turbulent_vial_of_toxin
0:12.530 sinister_strike Fluffy_Pillow 119.8/135: 89% energy | 4.0/5: 80% combo_points bloodlust, bandits_guile(7), adrenaline_rush, shallow_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(5), mark_of_warsong_oh(10), draenic_agility_potion, turbulent_vial_of_toxin
0:13.333 sinister_strike Fluffy_Pillow 104.5/135: 77% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(8), adrenaline_rush, moderate_insight, slice_and_dice, anticipation, exquisite_proficiency, mark_of_warsong(5), mark_of_warsong_oh(9), draenic_agility_potion, turbulent_vial_of_toxin
0:14.137 sinister_strike Fluffy_Pillow 89.1/135: 66% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(9), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(2), exquisite_proficiency, mark_of_warsong(4), mark_of_warsong_oh(9), draenic_agility_potion, turbulent_vial_of_toxin
0:14.942 sinister_strike Fluffy_Pillow 73.4/135: 54% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(10), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(4), exquisite_proficiency, mark_of_warsong(4), mark_of_warsong_oh(8), draenic_agility_potion, turbulent_vial_of_toxin
0:15.745 eviscerate Fluffy_Pillow 57.4/135: 43% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(11), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(5), exquisite_proficiency, mark_of_warsong(4), mark_of_warsong_oh(8), draenic_agility_potion
0:16.547 sinister_strike Fluffy_Pillow 81.2/135: 60% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(11), adrenaline_rush, moderate_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(3), mark_of_warsong_oh(8), draenic_agility_potion
0:17.352 eviscerate Fluffy_Pillow 79.8/135: 59% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, anticipation, exquisite_proficiency, mark_of_warsong(3), mark_of_warsong_oh(7), draenic_agility_potion
0:18.158 sinister_strike Fluffy_Pillow 103.2/135: 76% energy | 2.0/5: 40% combo_points bloodlust, bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(2), mark_of_warsong_oh(7), draenic_agility_potion
0:18.962 sinister_strike Fluffy_Pillow 86.3/135: 64% energy | 4.0/5: 80% combo_points bloodlust, bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(2), mark_of_warsong_oh(6), draenic_agility_potion
0:19.766 eviscerate Fluffy_Pillow 69.2/135: 51% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, anticipation, exquisite_proficiency, mark_of_warsong(2), mark_of_warsong_oh(6), draenic_agility_potion
0:20.569 sinister_strike Fluffy_Pillow 101.2/135: 75% energy | 2.0/5: 40% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong, mark_of_warsong_oh(6)
0:21.575 vanish Fluffy_Pillow 71.4/135: 53% energy | 3.0/5: 60% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong, mark_of_warsong_oh(5)
0:21.575 ambush Fluffy_Pillow 71.4/135: 53% energy | 3.0/5: 60% combo_points bloodlust, bandits_guile(12), deep_insight, stealth, vanish, slice_and_dice, exquisite_proficiency, mark_of_warsong, mark_of_warsong_oh(5)
0:22.579 preparation Fluffy_Pillow 91.5/135: 68% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong_oh(5)
0:23.583 eviscerate Fluffy_Pillow 126.3/135: 94% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong_oh(4)
0:24.587 sinister_strike Fluffy_Pillow 135.0/135: 100% energy | 1.0/5: 20% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong_oh(4)
0:25.590 sinister_strike Fluffy_Pillow 119.6/135: 89% energy | 2.0/5: 40% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong_oh(3)
0:26.598 sinister_strike Fluffy_Pillow 104.3/135: 77% energy | 3.0/5: 60% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong_oh(3)
0:27.603 vanish Fluffy_Pillow 73.8/135: 55% energy | 4.0/5: 80% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong_oh(2)
0:27.603 ambush Fluffy_Pillow 73.8/135: 55% energy | 4.0/5: 80% combo_points bloodlust, bandits_guile(12), deep_insight, stealth, vanish, slice_and_dice, mark_of_warsong_oh(2)
0:28.609 eviscerate Fluffy_Pillow 108.3/135: 80% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, anticipation, mark_of_warsong_oh(2)
0:29.614 revealing_strike Fluffy_Pillow 117.6/135: 87% energy | 2.0/5: 40% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong_oh
0:30.618 sinister_strike Fluffy_Pillow 98.0/135: 73% energy | 3.0/5: 60% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(10), mark_of_warsong_oh
0:31.623 sinister_strike Fluffy_Pillow 68.9/135: 51% energy | 4.0/5: 80% combo_points bloodlust, slice_and_dice, mark_of_warsong(10)
0:32.628 Waiting 0.300 sec 39.8/135: 29% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile, slice_and_dice, mark_of_warsong(9)
0:32.928 sinister_strike Fluffy_Pillow 61.0/135: 45% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile, slice_and_dice, mark_of_warsong(9)
0:33.933 Waiting 0.200 sec 31.7/135: 23% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(2), slice_and_dice, anticipation, mark_of_warsong(9)
0:34.133 sinister_strike Fluffy_Pillow 50.8/135: 38% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(2), slice_and_dice, anticipation, mark_of_warsong(8)
0:35.137 Waiting 1.474 sec 21.4/135: 16% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(3), slice_and_dice, anticipation(2), mark_of_warsong(10)
0:36.611 sinister_strike Fluffy_Pillow 52.1/135: 39% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(3), slice_and_dice, anticipation(2), mark_of_warsong(10)
0:37.614 eviscerate Fluffy_Pillow 37.9/135: 28% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(4), shallow_insight, slice_and_dice, anticipation(4), mark_of_warsong(9)
0:38.620 sinister_strike Fluffy_Pillow 63.6/135: 47% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(4), shallow_insight, slice_and_dice, mark_of_warsong(9)
0:39.624 Waiting 0.100 sec 49.3/135: 37% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(5), shallow_insight, slice_and_dice, anticipation(2), mark_of_warsong(8)
0:39.724 sinister_strike Fluffy_Pillow 51.3/135: 38% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(5), shallow_insight, slice_and_dice, anticipation(2), mark_of_warsong(8)
0:40.728 kick Fluffy_Pillow 21.9/135: 16% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(6), shallow_insight, slice_and_dice, anticipation(3), mark_of_warsong(8)
0:40.728 Waiting 1.752 sec 21.9/135: 16% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(6), shallow_insight, slice_and_dice, anticipation(3), mark_of_warsong(8)
0:42.480 sinister_strike Fluffy_Pillow 50.9/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(6), shallow_insight, slice_and_dice, anticipation(3), mark_of_warsong(10)
0:43.484 Waiting 0.603 sec 17.0/135: 13% energy | 5.0/5: 100% combo_points bandits_guile(7), shallow_insight, slice_and_dice, anticipation(5), mark_of_warsong(9)
0:44.087 slice_and_dice Fluffy_Pillow 26.6/135: 20% energy | 5.0/5: 100% combo_points bandits_guile(7), shallow_insight, slice_and_dice, anticipation(5), mark_of_warsong(9)
0:45.092 Waiting 0.500 sec 42.5/135: 32% energy | 1.0/5: 20% combo_points bandits_guile(7), shallow_insight, slice_and_dice, anticipation(5), mark_of_warsong(9)
0:45.592 sinister_strike Fluffy_Pillow 50.4/135: 37% energy | 1.0/5: 20% combo_points bandits_guile(7), shallow_insight, slice_and_dice, anticipation(5), mark_of_warsong(8)
0:46.596 Waiting 2.255 sec 16.2/135: 12% energy | 2.0/5: 40% combo_points bandits_guile(8), moderate_insight, slice_and_dice, anticipation(5), mark_of_warsong(8)
0:48.851 sinister_strike Fluffy_Pillow 51.5/135: 38% energy | 2.0/5: 40% combo_points bandits_guile(8), moderate_insight, slice_and_dice, anticipation(5), mark_of_warsong(7)
0:49.856 Waiting 0.600 sec 32.1/135: 24% energy | 4.0/5: 80% combo_points bandits_guile(9), moderate_insight, slice_and_dice, anticipation(5), mark_of_warsong(6)
0:50.456 revealing_strike Fluffy_Pillow 41.4/135: 31% energy | 4.0/5: 80% combo_points bandits_guile(9), moderate_insight, slice_and_dice, anticipation(5), mark_of_warsong(6)
0:51.460 Waiting 0.300 sec 31.9/135: 24% energy | 5.0/5: 100% combo_points bandits_guile(9), moderate_insight, slice_and_dice, anticipation(5), mark_of_warsong(5)
0:51.760 eviscerate Fluffy_Pillow 36.5/135: 27% energy | 5.0/5: 100% combo_points bandits_guile(9), moderate_insight, slice_and_dice, anticipation(5), mark_of_warsong(5)
0:52.763 Waiting 0.600 sec 41.9/135: 31% energy | 5.0/5: 100% combo_points bandits_guile(9), moderate_insight, slice_and_dice, mark_of_warsong(5)
0:53.363 sinister_strike Fluffy_Pillow 51.1/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(9), moderate_insight, slice_and_dice, mark_of_warsong(4)
0:54.367 killing_spree Fluffy_Pillow 16.3/135: 12% energy | 5.0/5: 100% combo_points bandits_guile(10), moderate_insight, slice_and_dice, anticipation(2), mark_of_warsong(4)
0:57.466 sinister_strike Fluffy_Pillow 123.0/135: 91% energy | 5.0/5: 100% combo_points bandits_guile(10), moderate_insight, slice_and_dice, anticipation(2), mark_of_warsong(2)
0:58.472 sinister_strike Fluffy_Pillow 88.0/135: 65% energy | 5.0/5: 100% combo_points bandits_guile(11), moderate_insight, slice_and_dice, anticipation(3), mark_of_warsong(2)
0:59.477 eviscerate Fluffy_Pillow 53.0/135: 39% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, anticipation(4), mark_of_warsong
1:00.481 eviscerate Fluffy_Pillow 57.8/135: 43% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong
1:01.485 sinister_strike Fluffy_Pillow 62.6/135: 46% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice
1:02.489 Waiting 0.800 sec 27.3/135: 20% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice
1:03.289 sinister_strike Fluffy_Pillow 54.0/135: 40% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice
1:04.292 Waiting 1.200 sec 33.6/135: 25% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice
1:05.492 sinister_strike Fluffy_Pillow 51.2/135: 38% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice
1:06.499 Waiting 1.400 sec 30.9/135: 23% energy | 4.0/5: 80% combo_points bandits_guile(12), deep_insight, slice_and_dice
1:07.899 sinister_strike Fluffy_Pillow 51.4/135: 38% energy | 4.0/5: 80% combo_points bandits_guile(12), deep_insight, slice_and_dice
1:08.904 Waiting 0.810 sec 16.1/135: 12% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency
1:09.714 eviscerate Fluffy_Pillow 42.9/135: 32% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency
1:10.720 Waiting 0.200 sec 47.6/135: 35% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency
1:10.920 sinister_strike Fluffy_Pillow 50.5/135: 37% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency
1:11.925 Waiting 2.467 sec 15.2/135: 11% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency
1:14.392 sinister_strike Fluffy_Pillow 51.3/135: 38% energy | 2.0/5: 40% combo_points slice_and_dice, exquisite_proficiency
1:15.395 Waiting 0.700 sec 31.0/135: 23% energy | 3.0/5: 60% combo_points bandits_guile, slice_and_dice, exquisite_proficiency
1:16.095 sinister_strike Fluffy_Pillow 56.2/135: 42% energy | 3.0/5: 60% combo_points bandits_guile, slice_and_dice, exquisite_proficiency
1:17.101 Waiting 0.579 sec 20.9/135: 15% energy | 5.0/5: 100% combo_points bandits_guile(2), slice_and_dice, exquisite_proficiency
1:17.680 revealing_strike Fluffy_Pillow 44.4/135: 33% energy | 5.0/5: 100% combo_points bandits_guile(2), slice_and_dice, exquisite_proficiency
1:18.684 kick Fluffy_Pillow 19.1/135: 14% energy | 5.0/5: 100% combo_points bandits_guile(2), slice_and_dice, anticipation, exquisite_proficiency
1:18.684 Waiting 0.506 sec 19.1/135: 14% energy | 5.0/5: 100% combo_points bandits_guile(2), slice_and_dice, anticipation, exquisite_proficiency
1:19.190 slice_and_dice Fluffy_Pillow 26.5/135: 20% energy | 5.0/5: 100% combo_points bandits_guile(2), slice_and_dice, anticipation, exquisite_proficiency
1:20.195 sinister_strike Fluffy_Pillow 56.1/135: 42% energy | 1.0/5: 20% combo_points bandits_guile(2), slice_and_dice, anticipation, exquisite_proficiency
1:21.200 Waiting 1.000 sec 35.8/135: 27% energy | 2.0/5: 40% combo_points bandits_guile(3), slice_and_dice, anticipation, exquisite_proficiency
1:22.200 sinister_strike Fluffy_Pillow 50.5/135: 37% energy | 2.0/5: 40% combo_points bandits_guile(3), slice_and_dice, anticipation, exquisite_proficiency
1:23.204 Waiting 1.400 sec 30.1/135: 22% energy | 3.0/5: 60% combo_points bandits_guile(4), shallow_insight, slice_and_dice, anticipation, exquisite_proficiency
1:24.604 sinister_strike Fluffy_Pillow 50.6/135: 37% energy | 3.0/5: 60% combo_points bandits_guile(4), shallow_insight, slice_and_dice, anticipation, exquisite_proficiency
1:25.609 adrenaline_rush Fluffy_Pillow 15.3/135: 11% energy | 4.0/5: 80% combo_points bandits_guile(5), shallow_insight, slice_and_dice, anticipation, exquisite_proficiency
1:25.609 potion Fluffy_Pillow 15.3/135: 11% energy | 4.0/5: 80% combo_points bandits_guile(5), adrenaline_rush, shallow_insight, slice_and_dice, anticipation, exquisite_proficiency
1:25.609 Waiting 1.263 sec 15.3/135: 11% energy | 4.0/5: 80% combo_points bandits_guile(5), adrenaline_rush, shallow_insight, slice_and_dice, anticipation, exquisite_proficiency, draenic_agility_potion
1:26.872 sinister_strike Fluffy_Pillow 52.2/135: 39% energy | 4.0/5: 80% combo_points bandits_guile(5), adrenaline_rush, shallow_insight, slice_and_dice, anticipation, exquisite_proficiency, draenic_agility_potion
1:27.675 Waiting 0.900 sec 25.7/135: 19% energy | 5.0/5: 100% combo_points bandits_guile(6), adrenaline_rush, shallow_insight, slice_and_dice, anticipation, exquisite_proficiency, draenic_agility_potion
1:28.575 sinister_strike Fluffy_Pillow 52.0/135: 39% energy | 5.0/5: 100% combo_points bandits_guile(6), adrenaline_rush, shallow_insight, slice_and_dice, anticipation, draenic_agility_potion
1:29.380 Waiting 0.700 sec 25.6/135: 19% energy | 5.0/5: 100% combo_points bandits_guile(7), adrenaline_rush, shallow_insight, slice_and_dice, anticipation(2), draenic_agility_potion
1:30.080 use_item_turbulent_vial_of_toxin Fluffy_Pillow 46.0/135: 34% energy | 5.0/5: 100% combo_points bandits_guile(7), adrenaline_rush, shallow_insight, slice_and_dice, anticipation(2), draenic_agility_potion
1:30.080 Waiting 0.200 sec 46.0/135: 34% energy | 5.0/5: 100% combo_points bandits_guile(7), adrenaline_rush, shallow_insight, slice_and_dice, anticipation(2), draenic_agility_potion, turbulent_vial_of_toxin
1:30.280 sinister_strike Fluffy_Pillow 51.9/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(7), adrenaline_rush, shallow_insight, slice_and_dice, anticipation(2), draenic_agility_potion, turbulent_vial_of_toxin
1:31.086 Waiting 0.400 sec 40.4/135: 30% energy | 5.0/5: 100% combo_points bandits_guile(8), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(3), draenic_agility_potion, turbulent_vial_of_toxin
1:31.486 sinister_strike Fluffy_Pillow 52.1/135: 39% energy | 5.0/5: 100% combo_points bandits_guile(8), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(3), draenic_agility_potion, turbulent_vial_of_toxin
1:32.289 Waiting 0.100 sec 25.6/135: 19% energy | 5.0/5: 100% combo_points bandits_guile(9), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(4), draenic_agility_potion, turbulent_vial_of_toxin
1:32.389 eviscerate Fluffy_Pillow 43.5/135: 32% energy | 5.0/5: 100% combo_points bandits_guile(9), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(4), draenic_agility_potion, turbulent_vial_of_toxin
1:33.194 sinister_strike Fluffy_Pillow 57.1/135: 42% energy | 5.0/5: 100% combo_points bandits_guile(9), adrenaline_rush, moderate_insight, slice_and_dice, draenic_agility_potion, turbulent_vial_of_toxin
1:34.000 Waiting 0.200 sec 45.6/135: 34% energy | 5.0/5: 100% combo_points bandits_guile(10), adrenaline_rush, moderate_insight, slice_and_dice, anticipation, draenic_agility_potion, turbulent_vial_of_toxin
1:34.200 sinister_strike Fluffy_Pillow 51.5/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(10), adrenaline_rush, moderate_insight, slice_and_dice, anticipation, draenic_agility_potion, turbulent_vial_of_toxin
1:35.003 Waiting 0.400 sec 25.0/135: 18% energy | 5.0/5: 100% combo_points bandits_guile(11), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(2), draenic_agility_potion, turbulent_vial_of_toxin
1:35.403 sinister_strike Fluffy_Pillow 51.7/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(11), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(2), draenic_agility_potion, turbulent_vial_of_toxin
1:36.208 Waiting 0.200 sec 25.2/135: 19% energy | 5.0/5: 100% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, anticipation(3), draenic_agility_potion, turbulent_vial_of_toxin
1:36.408 eviscerate Fluffy_Pillow 46.1/135: 34% energy | 5.0/5: 100% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, anticipation(3), draenic_agility_potion, turbulent_vial_of_toxin
1:37.212 revealing_strike Fluffy_Pillow 59.6/135: 44% energy | 4.0/5: 80% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, draenic_agility_potion, turbulent_vial_of_toxin
1:38.017 eviscerate Fluffy_Pillow 58.1/135: 43% energy | 5.0/5: 100% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, draenic_agility_potion, turbulent_vial_of_toxin
1:38.823 sinister_strike Fluffy_Pillow 71.7/135: 53% energy | 1.0/5: 20% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, draenic_agility_potion, turbulent_vial_of_toxin
1:39.628 Waiting 0.200 sec 45.2/135: 33% energy | 2.0/5: 40% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, draenic_agility_potion, turbulent_vial_of_toxin
1:39.828 sinister_strike Fluffy_Pillow 51.0/135: 38% energy | 2.0/5: 40% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, draenic_agility_potion, turbulent_vial_of_toxin
1:40.632 vanish Fluffy_Pillow 24.2/135: 18% energy | 4.0/5: 80% combo_points bandits_guile(12), deep_insight, slice_and_dice, draenic_agility_potion, turbulent_vial_of_toxin
1:40.632 ambush Fluffy_Pillow 24.2/135: 18% energy | 4.0/5: 80% combo_points bandits_guile(12), deep_insight, stealth, vanish, slice_and_dice, draenic_agility_potion, turbulent_vial_of_toxin
1:41.639 eviscerate Fluffy_Pillow 38.9/135: 29% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, anticipation, draenic_agility_potion, turbulent_vial_of_toxin
1:42.644 Waiting 0.500 sec 43.6/135: 32% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice, draenic_agility_potion, turbulent_vial_of_toxin
1:43.144 sinister_strike Fluffy_Pillow 50.9/135: 38% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice, draenic_agility_potion, turbulent_vial_of_toxin
1:44.150 Waiting 0.639 sec 15.7/135: 12% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice, draenic_agility_potion, turbulent_vial_of_toxin
1:44.789 killing_spree Fluffy_Pillow 40.0/135: 30% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice, draenic_agility_potion, turbulent_vial_of_toxin
1:47.963 sinister_strike Fluffy_Pillow 135.0/135: 100% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong_oh(9), draenic_agility_potion
1:48.966 sinister_strike Fluffy_Pillow 100.9/135: 75% energy | 4.0/5: 80% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong_oh(9), draenic_agility_potion
1:49.972 eviscerate Fluffy_Pillow 66.9/135: 50% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong_oh(8), draenic_agility_potion
1:50.978 sinister_strike Fluffy_Pillow 72.7/135: 54% energy | 1.0/5: 20% combo_points slice_and_dice, mark_of_warsong_oh(8)
1:51.982 Waiting 0.800 sec 38.5/135: 29% energy | 2.0/5: 40% combo_points bandits_guile, slice_and_dice, mark_of_warsong_oh(7)
1:52.782 sinister_strike Fluffy_Pillow 51.0/135: 38% energy | 2.0/5: 40% combo_points bandits_guile, slice_and_dice, mark_of_warsong_oh(7)
1:53.789 Waiting 1.200 sec 31.7/135: 23% energy | 3.0/5: 60% combo_points bandits_guile(2), slice_and_dice, mark_of_warsong_oh(6)
1:54.989 sinister_strike Fluffy_Pillow 50.2/135: 37% energy | 3.0/5: 60% combo_points bandits_guile(2), slice_and_dice, mark_of_warsong_oh(6)
1:55.992 kick Fluffy_Pillow 30.7/135: 23% energy | 4.0/5: 80% combo_points bandits_guile(3), slice_and_dice, mark_of_warsong_oh(5)
1:55.992 Waiting 1.300 sec 30.7/135: 23% energy | 4.0/5: 80% combo_points bandits_guile(3), slice_and_dice, mark_of_warsong_oh(5)
1:57.292 sinister_strike Fluffy_Pillow 50.6/135: 38% energy | 4.0/5: 80% combo_points bandits_guile(3), slice_and_dice, mark_of_warsong_oh(5)
1:58.296 Waiting 0.696 sec 16.0/135: 12% energy | 5.0/5: 100% combo_points bandits_guile(4), shallow_insight, slice_and_dice, anticipation, mark_of_warsong_oh(4)
1:58.992 slice_and_dice Fluffy_Pillow 26.5/135: 20% energy | 5.0/5: 100% combo_points bandits_guile(4), shallow_insight, slice_and_dice, anticipation, mark_of_warsong_oh(4)
1:59.995 Waiting 0.600 sec 41.7/135: 31% energy | 1.0/5: 20% combo_points bandits_guile(4), shallow_insight, slice_and_dice, anticipation, mark_of_warsong_oh(3)
2:00.595 sinister_strike Fluffy_Pillow 50.7/135: 38% energy | 1.0/5: 20% combo_points bandits_guile(4), shallow_insight, slice_and_dice, anticipation, mark_of_warsong_oh(3)
2:01.600 Waiting 2.308 sec 15.9/135: 12% energy | 2.0/5: 40% combo_points bandits_guile(5), shallow_insight, slice_and_dice, anticipation, mark_of_warsong_oh(3)
2:03.908 sinister_strike Fluffy_Pillow 50.3/135: 37% energy | 2.0/5: 40% combo_points bandits_guile(5), shallow_insight, slice_and_dice, anticipation, mark_of_warsong_oh
2:04.913 Waiting 0.800 sec 30.1/135: 22% energy | 3.0/5: 60% combo_points bandits_guile(6), shallow_insight, slice_and_dice, anticipation, mark_of_warsong_oh
2:05.713 revealing_strike Fluffy_Pillow 41.9/135: 31% energy | 3.0/5: 60% combo_points bandits_guile(6), shallow_insight, slice_and_dice, anticipation, mark_of_warsong_oh
2:06.717 Waiting 2.175 sec 16.6/135: 12% energy | 4.0/5: 80% combo_points bandits_guile(6), shallow_insight, slice_and_dice, anticipation
2:08.892 sinister_strike Fluffy_Pillow 51.4/135: 38% energy | 4.0/5: 80% combo_points bandits_guile(6), shallow_insight, slice_and_dice, anticipation, mark_of_warsong_oh(9)
2:09.897 Waiting 0.200 sec 47.3/135: 35% energy | 5.0/5: 100% combo_points bandits_guile(7), shallow_insight, slice_and_dice, anticipation, mark_of_warsong_oh(9)
2:10.097 sinister_strike Fluffy_Pillow 50.5/135: 37% energy | 5.0/5: 100% combo_points bandits_guile(7), shallow_insight, slice_and_dice, anticipation, mark_of_warsong_oh(9)
2:11.103 Waiting 0.900 sec 31.4/135: 23% energy | 5.0/5: 100% combo_points bandits_guile(8), moderate_insight, slice_and_dice, anticipation(2), mark_of_warsong_oh(8)
2:12.003 sinister_strike Fluffy_Pillow 60.6/135: 45% energy | 5.0/5: 100% combo_points bandits_guile(8), moderate_insight, slice_and_dice, anticipation(2), mark_of_warsong_oh(8)
2:13.008 Waiting 0.600 sec 26.4/135: 20% energy | 5.0/5: 100% combo_points bandits_guile(9), moderate_insight, slice_and_dice, anticipation(4), mark_of_warsong_oh(7)
2:13.608 eviscerate Fluffy_Pillow 35.7/135: 26% energy | 5.0/5: 100% combo_points bandits_guile(9), moderate_insight, slice_and_dice, anticipation(4), mark_of_warsong_oh(7)
2:14.613 Waiting 0.600 sec 41.4/135: 31% energy | 5.0/5: 100% combo_points bandits_guile(9), moderate_insight, slice_and_dice, mark_of_warsong_oh(7)
2:15.213 sinister_strike Fluffy_Pillow 50.7/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(9), moderate_insight, slice_and_dice, mark_of_warsong_oh(6)
2:16.217 Waiting 1.766 sec 16.2/135: 12% energy | 5.0/5: 100% combo_points bandits_guile(10), moderate_insight, slice_and_dice, anticipation, exquisite_proficiency, mark_of_warsong_oh(6)
2:17.983 sinister_strike Fluffy_Pillow 58.4/135: 43% energy | 5.0/5: 100% combo_points bandits_guile(10), moderate_insight, slice_and_dice, anticipation, exquisite_proficiency, mark_of_warsong_oh(5)
2:18.988 Waiting 1.800 sec 23.7/135: 18% energy | 5.0/5: 100% combo_points bandits_guile(11), moderate_insight, slice_and_dice, anticipation(2), exquisite_proficiency, mark_of_warsong_oh(4)
2:20.788 sinister_strike Fluffy_Pillow 51.1/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(11), moderate_insight, slice_and_dice, anticipation(2), exquisite_proficiency, mark_of_warsong_oh(3)
2:21.792 Waiting 0.787 sec 16.2/135: 12% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, anticipation(3), exquisite_proficiency, mark_of_warsong_oh(3)
2:22.579 eviscerate Fluffy_Pillow 43.0/135: 32% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, anticipation(3), exquisite_proficiency, mark_of_warsong(10), mark_of_warsong_oh(3)
2:23.584 revealing_strike Fluffy_Pillow 49.4/135: 37% energy | 4.0/5: 80% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(10), mark_of_warsong_oh(2)
2:24.590 eviscerate Fluffy_Pillow 40.8/135: 30% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(9), mark_of_warsong_oh(2)
2:25.593 sinister_strike Fluffy_Pillow 61.9/135: 46% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(9), mark_of_warsong_oh
2:26.597 Waiting 0.500 sec 43.0/135: 32% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(8), mark_of_warsong_oh
2:27.097 sinister_strike Fluffy_Pillow 50.9/135: 38% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(8)
2:28.103 Waiting 1.824 sec 16.7/135: 12% energy | 4.0/5: 80% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(8)
2:29.927 sinister_strike Fluffy_Pillow 60.3/135: 45% energy | 4.0/5: 80% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(7)
2:30.931 eviscerate Fluffy_Pillow 40.9/135: 30% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(6)
2:31.934 sinister_strike Fluffy_Pillow 61.4/135: 45% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(6)
2:32.939 Waiting 1.200 sec 26.9/135: 20% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(5)
2:34.139 kick Fluffy_Pillow 45.3/135: 34% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(5)
2:34.139 Waiting 0.300 sec 45.3/135: 34% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(10)
2:34.439 sinister_strike Fluffy_Pillow 50.1/135: 37% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(10)
2:35.443 Waiting 1.952 sec 16.1/135: 12% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(10)
2:37.395 sinister_strike Fluffy_Pillow 62.2/135: 46% energy | 3.0/5: 60% combo_points slice_and_dice, mark_of_warsong(9)
2:38.399 Waiting 1.400 sec 28.2/135: 21% energy | 4.0/5: 80% combo_points bandits_guile, slice_and_dice, mark_of_warsong(8)
2:39.799 sinister_strike Fluffy_Pillow 50.2/135: 37% energy | 4.0/5: 80% combo_points bandits_guile, slice_and_dice, mark_of_warsong(8)
2:40.802 vanish Fluffy_Pillow 30.9/135: 23% energy | 5.0/5: 100% combo_points bandits_guile(2), slice_and_dice, mark_of_warsong(7)
2:40.802 ambush Fluffy_Pillow 30.9/135: 23% energy | 5.0/5: 100% combo_points bandits_guile(2), stealth, vanish, slice_and_dice, mark_of_warsong(7)
2:41.806 slice_and_dice Fluffy_Pillow 30.7/135: 23% energy | 5.0/5: 100% combo_points bandits_guile(2), slice_and_dice, anticipation(2), mark_of_warsong(7)
2:42.811 Waiting 0.300 sec 46.2/135: 34% energy | 1.0/5: 20% combo_points bandits_guile(2), slice_and_dice, anticipation(2), mark_of_warsong(6)
2:43.111 sinister_strike Fluffy_Pillow 65.9/135: 49% energy | 1.0/5: 20% combo_points bandits_guile(2), slice_and_dice, anticipation(2), mark_of_warsong(6)
2:44.115 Waiting 0.500 sec 31.4/135: 23% energy | 2.0/5: 40% combo_points bandits_guile(3), slice_and_dice, anticipation(2), mark_of_warsong(6)
2:44.615 sinister_strike Fluffy_Pillow 54.1/135: 40% energy | 2.0/5: 40% combo_points bandits_guile(3), slice_and_dice, anticipation(2), mark_of_warsong(5)
2:45.620 Waiting 1.060 sec 19.5/135: 14% energy | 3.0/5: 60% combo_points bandits_guile(4), shallow_insight, slice_and_dice, anticipation(2), mark_of_warsong(5)
2:46.680 sinister_strike Fluffy_Pillow 50.6/135: 38% energy | 3.0/5: 60% combo_points bandits_guile(4), shallow_insight, slice_and_dice, anticipation(2), mark_of_warsong(4)
2:47.684 Waiting 1.600 sec 15.9/135: 12% energy | 4.0/5: 80% combo_points bandits_guile(5), shallow_insight, slice_and_dice, anticipation(2), mark_of_warsong(4)
2:49.284 revealing_strike Fluffy_Pillow 40.0/135: 30% energy | 4.0/5: 80% combo_points bandits_guile(5), shallow_insight, slice_and_dice, anticipation(2), mark_of_warsong(3)
2:50.290 Waiting 2.263 sec 15.1/135: 11% energy | 5.0/5: 100% combo_points bandits_guile(5), shallow_insight, slice_and_dice, anticipation(2), mark_of_warsong(2)
2:52.553 sinister_strike Fluffy_Pillow 50.2/135: 37% energy | 5.0/5: 100% combo_points bandits_guile(5), shallow_insight, slice_and_dice, anticipation(2), mark_of_warsong, mark_of_warsong_oh(10)
2:53.558 Waiting 1.233 sec 16.4/135: 12% energy | 5.0/5: 100% combo_points bandits_guile(6), shallow_insight, slice_and_dice, anticipation(3), mark_of_warsong, mark_of_warsong_oh(9)
2:54.791 sinister_strike Fluffy_Pillow 51.1/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(6), shallow_insight, slice_and_dice, anticipation(3), mark_of_warsong_oh(9)
2:55.796 killing_spree Fluffy_Pillow 17.0/135: 13% energy | 5.0/5: 100% combo_points bandits_guile(7), shallow_insight, slice_and_dice, anticipation(5), mark_of_warsong_oh(8)
2:59.015 eviscerate Fluffy_Pillow 135.0/135: 100% energy | 5.0/5: 100% combo_points bandits_guile(7), shallow_insight, slice_and_dice, anticipation(5), mark_of_warsong(9), mark_of_warsong_oh(7)
3:00.020 sinister_strike Fluffy_Pillow 135.0/135: 100% energy | 5.0/5: 100% combo_points bandits_guile(7), shallow_insight, slice_and_dice, mark_of_warsong(9), mark_of_warsong_oh(6)
3:01.025 use_item_turbulent_vial_of_toxin Fluffy_Pillow 116.7/135: 86% energy | 5.0/5: 100% combo_points bandits_guile(8), moderate_insight, slice_and_dice, anticipation, mark_of_warsong(8), mark_of_warsong_oh(6)
3:01.025 sinister_strike Fluffy_Pillow 116.7/135: 86% energy | 5.0/5: 100% combo_points bandits_guile(8), moderate_insight, slice_and_dice, anticipation, mark_of_warsong(8), mark_of_warsong_oh(6), turbulent_vial_of_toxin
3:02.029 sinister_strike Fluffy_Pillow 98.3/135: 73% energy | 5.0/5: 100% combo_points bandits_guile(9), moderate_insight, slice_and_dice, anticipation(2), mark_of_warsong(8), mark_of_warsong_oh(5), turbulent_vial_of_toxin
3:03.033 sinister_strike Fluffy_Pillow 64.7/135: 48% energy | 5.0/5: 100% combo_points bandits_guile(10), moderate_insight, slice_and_dice, anticipation(3), mark_of_warsong(7), mark_of_warsong_oh(5), turbulent_vial_of_toxin
3:04.038 adrenaline_rush Fluffy_Pillow 31.0/135: 23% energy | 5.0/5: 100% combo_points bandits_guile(11), moderate_insight, slice_and_dice, anticipation(4), mark_of_warsong(7), mark_of_warsong_oh(4), turbulent_vial_of_toxin
3:04.038 Waiting 0.200 sec 31.0/135: 23% energy | 5.0/5: 100% combo_points bandits_guile(11), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(4), mark_of_warsong(7), mark_of_warsong_oh(4), turbulent_vial_of_toxin
3:04.238 eviscerate Fluffy_Pillow 37.5/135: 28% energy | 5.0/5: 100% combo_points bandits_guile(11), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(4), mark_of_warsong(7), mark_of_warsong_oh(4), turbulent_vial_of_toxin
3:05.043 sinister_strike Fluffy_Pillow 53.3/135: 39% energy | 5.0/5: 100% combo_points bandits_guile(11), adrenaline_rush, moderate_insight, slice_and_dice, mark_of_warsong(6), mark_of_warsong_oh(4), turbulent_vial_of_toxin
3:05.846 Waiting 0.200 sec 28.9/135: 21% energy | 5.0/5: 100% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, anticipation, mark_of_warsong(6), mark_of_warsong_oh(3), turbulent_vial_of_toxin
3:06.046 eviscerate Fluffy_Pillow 35.3/135: 26% energy | 5.0/5: 100% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, anticipation, mark_of_warsong(6), mark_of_warsong_oh(3), turbulent_vial_of_toxin
3:06.850 sinister_strike Fluffy_Pillow 50.7/135: 38% energy | 2.0/5: 40% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong(5), mark_of_warsong_oh(3), turbulent_vial_of_toxin
3:07.654 Waiting 0.800 sec 25.9/135: 19% energy | 3.0/5: 60% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong(5), mark_of_warsong_oh(2), turbulent_vial_of_toxin
3:08.454 sinister_strike Fluffy_Pillow 50.9/135: 38% energy | 3.0/5: 60% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong(4), mark_of_warsong_oh(2), turbulent_vial_of_toxin
3:09.258 Waiting 0.800 sec 25.7/135: 19% energy | 4.0/5: 80% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong(4), mark_of_warsong_oh(2), turbulent_vial_of_toxin
3:10.058 sinister_strike Fluffy_Pillow 50.3/135: 37% energy | 4.0/5: 80% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong(4), mark_of_warsong_oh, turbulent_vial_of_toxin
3:10.863 eviscerate Fluffy_Pillow 39.8/135: 30% energy | 5.0/5: 100% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong(3), mark_of_warsong_oh, turbulent_vial_of_toxin
3:11.669 kick Fluffy_Pillow 69.3/135: 51% energy | 1.0/5: 20% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong(3), turbulent_vial_of_toxin
3:11.669 sinister_strike Fluffy_Pillow 69.3/135: 51% energy | 1.0/5: 20% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong(3), turbulent_vial_of_toxin
3:12.474 Waiting 0.300 sec 43.4/135: 32% energy | 3.0/5: 60% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong(2), turbulent_vial_of_toxin
3:12.774 sinister_strike Fluffy_Pillow 52.4/135: 39% energy | 3.0/5: 60% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong(2), turbulent_vial_of_toxin
3:13.580 eviscerate Fluffy_Pillow 41.4/135: 31% energy | 5.0/5: 100% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong(2), turbulent_vial_of_toxin
3:14.384 sinister_strike Fluffy_Pillow 85.3/135: 63% energy | 1.0/5: 20% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong, turbulent_vial_of_toxin
3:15.188 sinister_strike Fluffy_Pillow 74.1/135: 55% energy | 3.0/5: 60% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong, turbulent_vial_of_toxin
3:15.993 slice_and_dice Fluffy_Pillow 62.8/135: 47% energy | 4.0/5: 80% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong, turbulent_vial_of_toxin
3:16.797 sinister_strike Fluffy_Pillow 101.4/135: 75% energy | 1.0/5: 20% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice
3:17.604 sinister_strike Fluffy_Pillow 75.0/135: 56% energy | 2.0/5: 40% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice
3:18.409 revealing_strike Fluffy_Pillow 63.5/135: 47% energy | 4.0/5: 80% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice
3:19.213 eviscerate Fluffy_Pillow 44.5/135: 33% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice
3:20.218 Waiting 0.100 sec 49.2/135: 36% energy | 1.0/5: 20% combo_points slice_and_dice
3:20.318 sinister_strike Fluffy_Pillow 50.6/135: 38% energy | 1.0/5: 20% combo_points slice_and_dice
3:21.322 Waiting 1.400 sec 30.3/135: 22% energy | 2.0/5: 40% combo_points bandits_guile, slice_and_dice
3:22.722 sinister_strike Fluffy_Pillow 50.8/135: 38% energy | 2.0/5: 40% combo_points bandits_guile, slice_and_dice
3:23.727 Waiting 2.450 sec 15.5/135: 11% energy | 3.0/5: 60% combo_points bandits_guile(2), slice_and_dice
3:26.177 sinister_strike Fluffy_Pillow 51.3/135: 38% energy | 3.0/5: 60% combo_points bandits_guile(2), slice_and_dice, exquisite_proficiency
3:27.180 Waiting 0.617 sec 16.0/135: 12% energy | 4.0/5: 80% combo_points bandits_guile(3), slice_and_dice, exquisite_proficiency
3:27.797 sinister_strike Fluffy_Pillow 55.0/135: 41% energy | 4.0/5: 80% combo_points bandits_guile(3), slice_and_dice, exquisite_proficiency
3:28.802 Waiting 1.063 sec 19.7/135: 15% energy | 5.0/5: 100% combo_points bandits_guile(4), shallow_insight, slice_and_dice, anticipation, exquisite_proficiency
3:29.865 sinister_strike Fluffy_Pillow 50.2/135: 37% energy | 5.0/5: 100% combo_points bandits_guile(4), shallow_insight, slice_and_dice, anticipation, exquisite_proficiency
3:30.869 Waiting 2.490 sec 14.9/135: 11% energy | 5.0/5: 100% combo_points bandits_guile(5), shallow_insight, slice_and_dice, anticipation(2), exquisite_proficiency
3:33.359 sinister_strike Fluffy_Pillow 51.3/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(5), shallow_insight, slice_and_dice, anticipation(2), exquisite_proficiency
3:34.364 Waiting 1.715 sec 16.0/135: 12% energy | 5.0/5: 100% combo_points bandits_guile(6), shallow_insight, slice_and_dice, anticipation(3), exquisite_proficiency
3:36.079 slice_and_dice Fluffy_Pillow 41.1/135: 30% energy | 5.0/5: 100% combo_points bandits_guile(6), shallow_insight, slice_and_dice, anticipation(3), exquisite_proficiency
3:37.082 sinister_strike Fluffy_Pillow 55.7/135: 41% energy | 1.0/5: 20% combo_points bandits_guile(6), shallow_insight, slice_and_dice, anticipation(3), exquisite_proficiency
3:38.088 Waiting 1.000 sec 35.4/135: 26% energy | 2.0/5: 40% combo_points bandits_guile(7), shallow_insight, slice_and_dice, anticipation(3), exquisite_proficiency
3:39.088 sinister_strike Fluffy_Pillow 50.1/135: 37% energy | 2.0/5: 40% combo_points bandits_guile(7), shallow_insight, slice_and_dice, anticipation(3), exquisite_proficiency
3:40.092 Waiting 0.800 sec 29.7/135: 22% energy | 3.0/5: 60% combo_points bandits_guile(8), moderate_insight, slice_and_dice, anticipation(3), exquisite_proficiency
3:40.892 vanish Fluffy_Pillow 41.4/135: 31% energy | 3.0/5: 60% combo_points bandits_guile(8), moderate_insight, slice_and_dice, anticipation(3), exquisite_proficiency
3:40.892 ambush Fluffy_Pillow 41.4/135: 31% energy | 3.0/5: 60% combo_points bandits_guile(8), moderate_insight, stealth, vanish, slice_and_dice, anticipation(3), exquisite_proficiency
3:41.898 Waiting 0.600 sec 41.1/135: 30% energy | 5.0/5: 100% combo_points bandits_guile(8), moderate_insight, slice_and_dice, anticipation(3), exquisite_proficiency
3:42.498 revealing_strike Fluffy_Pillow 49.9/135: 37% energy | 5.0/5: 100% combo_points bandits_guile(8), moderate_insight, slice_and_dice, anticipation(3), exquisite_proficiency
3:43.503 Waiting 0.800 sec 24.6/135: 18% energy | 5.0/5: 100% combo_points bandits_guile(8), moderate_insight, slice_and_dice, anticipation(4), exquisite_proficiency
3:44.303 eviscerate Fluffy_Pillow 36.3/135: 27% energy | 5.0/5: 100% combo_points bandits_guile(8), moderate_insight, slice_and_dice, anticipation(4), exquisite_proficiency
3:45.309 Waiting 0.700 sec 41.0/135: 30% energy | 5.0/5: 100% combo_points bandits_guile(8), moderate_insight, slice_and_dice, exquisite_proficiency
3:46.009 sinister_strike Fluffy_Pillow 51.2/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(8), moderate_insight, slice_and_dice
3:47.012 killing_spree Fluffy_Pillow 30.9/135: 23% energy | 5.0/5: 100% combo_points bandits_guile(9), moderate_insight, slice_and_dice, anticipation
3:50.237 kick Fluffy_Pillow 135.0/135: 100% energy | 5.0/5: 100% combo_points bandits_guile(9), moderate_insight, slice_and_dice, anticipation
3:50.237 sinister_strike Fluffy_Pillow 135.0/135: 100% energy | 5.0/5: 100% combo_points bandits_guile(9), moderate_insight, slice_and_dice, anticipation
3:51.243 sinister_strike Fluffy_Pillow 99.7/135: 74% energy | 5.0/5: 100% combo_points bandits_guile(10), moderate_insight, slice_and_dice, anticipation(3)
3:52.248 sinister_strike Fluffy_Pillow 64.4/135: 48% energy | 5.0/5: 100% combo_points bandits_guile(11), moderate_insight, slice_and_dice, anticipation(4)
3:53.254 Waiting 0.500 sec 29.1/135: 22% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, anticipation(5)
3:53.754 eviscerate Fluffy_Pillow 36.4/135: 27% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, anticipation(5)
3:54.760 eviscerate Fluffy_Pillow 56.1/135: 42% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice
3:55.765 sinister_strike Fluffy_Pillow 60.8/135: 45% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice
3:56.770 Waiting 1.700 sec 25.5/135: 19% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice
3:58.470 sinister_strike Fluffy_Pillow 50.4/135: 37% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice
3:59.475 Waiting 0.700 sec 30.1/135: 22% energy | 4.0/5: 80% combo_points bandits_guile(12), deep_insight, slice_and_dice
4:00.175 revealing_strike Fluffy_Pillow 40.3/135: 30% energy | 4.0/5: 80% combo_points bandits_guile(12), deep_insight, slice_and_dice
4:01.179 Waiting 0.400 sec 30.0/135: 22% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice
4:01.579 eviscerate Fluffy_Pillow 35.8/135: 27% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice
4:02.583 Waiting 0.700 sec 40.5/135: 30% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice
4:03.283 sinister_strike Fluffy_Pillow 50.7/135: 38% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice
4:04.289 Waiting 1.400 sec 30.4/135: 23% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice
4:05.689 sinister_strike Fluffy_Pillow 50.9/135: 38% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice
4:06.693 Waiting 0.400 sec 45.6/135: 34% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice
4:07.093 sinister_strike Fluffy_Pillow 51.4/135: 38% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice
4:08.096 Waiting 1.609 sec 16.1/135: 12% energy | 5.0/5: 100% combo_points slice_and_dice
4:09.705 sinister_strike Fluffy_Pillow 54.6/135: 40% energy | 5.0/5: 100% combo_points slice_and_dice
4:10.710 Waiting 0.200 sec 34.3/135: 25% energy | 5.0/5: 100% combo_points bandits_guile, slice_and_dice, anticipation
4:10.910 slice_and_dice Fluffy_Pillow 37.2/135: 28% energy | 5.0/5: 100% combo_points bandits_guile, slice_and_dice, anticipation
4:11.914 sinister_strike Fluffy_Pillow 51.9/135: 38% energy | 1.0/5: 20% combo_points bandits_guile, slice_and_dice, anticipation
4:12.919 Waiting 2.274 sec 16.6/135: 12% energy | 3.0/5: 60% combo_points bandits_guile(2), slice_and_dice, anticipation
4:15.193 sinister_strike Fluffy_Pillow 50.8/135: 38% energy | 3.0/5: 60% combo_points bandits_guile(2), slice_and_dice, anticipation, mark_of_warsong_oh(10)
4:16.197 Waiting 1.204 sec 16.9/135: 13% energy | 5.0/5: 100% combo_points bandits_guile(3), slice_and_dice, anticipation, mark_of_warsong_oh(10)
4:17.401 sinister_strike Fluffy_Pillow 51.1/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(3), slice_and_dice, anticipation, mark_of_warsong_oh(9)
4:18.405 Waiting 1.301 sec 17.0/135: 13% energy | 5.0/5: 100% combo_points bandits_guile(4), shallow_insight, slice_and_dice, anticipation(2), mark_of_warsong_oh(9)
4:19.706 sinister_strike Fluffy_Pillow 52.5/135: 39% energy | 5.0/5: 100% combo_points bandits_guile(4), shallow_insight, slice_and_dice, anticipation(2), mark_of_warsong_oh(8)
4:20.711 Waiting 1.128 sec 18.3/135: 14% energy | 5.0/5: 100% combo_points bandits_guile(5), shallow_insight, slice_and_dice, anticipation(4), mark_of_warsong_oh(7)
4:21.839 eviscerate Fluffy_Pillow 35.9/135: 27% energy | 5.0/5: 100% combo_points bandits_guile(5), shallow_insight, slice_and_dice, anticipation(4), mark_of_warsong_oh(7)
4:22.844 sinister_strike Fluffy_Pillow 56.5/135: 42% energy | 5.0/5: 100% combo_points bandits_guile(5), shallow_insight, slice_and_dice, mark_of_warsong_oh(6)
4:23.847 Waiting 0.290 sec 22.0/135: 16% energy | 5.0/5: 100% combo_points bandits_guile(6), shallow_insight, slice_and_dice, anticipation, mark_of_warsong_oh(6)
4:24.137 adrenaline_rush Fluffy_Pillow 26.5/135: 20% energy | 5.0/5: 100% combo_points bandits_guile(6), shallow_insight, slice_and_dice, anticipation, mark_of_warsong_oh(6)
4:24.137 Waiting 0.800 sec 26.5/135: 20% energy | 5.0/5: 100% combo_points bandits_guile(6), adrenaline_rush, shallow_insight, slice_and_dice, anticipation, mark_of_warsong_oh(6)
4:24.937 sinister_strike Fluffy_Pillow 51.8/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(6), adrenaline_rush, shallow_insight, slice_and_dice, anticipation, mark_of_warsong_oh(10)
4:25.742 Waiting 0.300 sec 42.6/135: 32% energy | 5.0/5: 100% combo_points bandits_guile(7), adrenaline_rush, shallow_insight, slice_and_dice, anticipation(2), mark_of_warsong_oh(10)
4:26.042 sinister_strike Fluffy_Pillow 52.2/135: 39% energy | 5.0/5: 100% combo_points bandits_guile(7), adrenaline_rush, shallow_insight, slice_and_dice, anticipation(2), mark_of_warsong_oh(10)
4:26.847 kick Fluffy_Pillow 57.9/135: 43% energy | 5.0/5: 100% combo_points bandits_guile(8), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(3), mark_of_warsong_oh(9)
4:26.847 sinister_strike Fluffy_Pillow 57.9/135: 43% energy | 5.0/5: 100% combo_points bandits_guile(8), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(3), mark_of_warsong_oh(9)
4:27.652 Waiting 0.100 sec 33.4/135: 25% energy | 5.0/5: 100% combo_points bandits_guile(9), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(4), mark_of_warsong_oh(9)
4:27.752 eviscerate Fluffy_Pillow 36.6/135: 27% energy | 5.0/5: 100% combo_points bandits_guile(9), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(4), mark_of_warsong_oh(9)
4:28.556 sinister_strike Fluffy_Pillow 52.1/135: 39% energy | 5.0/5: 100% combo_points bandits_guile(9), adrenaline_rush, moderate_insight, slice_and_dice, mark_of_warsong_oh(8)
4:29.360 Waiting 0.800 sec 27.5/135: 20% energy | 5.0/5: 100% combo_points bandits_guile(10), adrenaline_rush, moderate_insight, slice_and_dice, anticipation, mark_of_warsong_oh(8)
4:30.160 sinister_strike Fluffy_Pillow 52.6/135: 39% energy | 5.0/5: 100% combo_points bandits_guile(10), adrenaline_rush, moderate_insight, slice_and_dice, anticipation, mark_of_warsong_oh(8)
4:30.965 Waiting 0.100 sec 27.9/135: 21% energy | 5.0/5: 100% combo_points bandits_guile(11), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(3), mark_of_warsong_oh(7)
4:31.065 use_item_turbulent_vial_of_toxin Fluffy_Pillow 31.0/135: 23% energy | 5.0/5: 100% combo_points bandits_guile(11), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(3), mark_of_warsong_oh(7)
4:31.065 Waiting 0.300 sec 31.0/135: 23% energy | 5.0/5: 100% combo_points bandits_guile(11), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(3), mark_of_warsong_oh(7), turbulent_vial_of_toxin
4:31.365 revealing_strike Fluffy_Pillow 40.3/135: 30% energy | 5.0/5: 100% combo_points bandits_guile(11), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(3), mark_of_warsong_oh(7), turbulent_vial_of_toxin
4:32.170 eviscerate Fluffy_Pillow 40.5/135: 30% energy | 5.0/5: 100% combo_points bandits_guile(11), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(4), mark_of_warsong_oh(7), turbulent_vial_of_toxin
4:32.975 sinister_strike Fluffy_Pillow 70.4/135: 52% energy | 5.0/5: 100% combo_points bandits_guile(11), adrenaline_rush, moderate_insight, slice_and_dice, mark_of_warsong_oh(6), turbulent_vial_of_toxin
4:33.778 eviscerate Fluffy_Pillow 45.3/135: 34% energy | 5.0/5: 100% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, anticipation(2), mark_of_warsong_oh(6), turbulent_vial_of_toxin
4:34.584 sinister_strike Fluffy_Pillow 75.2/135: 56% energy | 3.0/5: 60% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong_oh(5), turbulent_vial_of_toxin
4:35.388 eviscerate Fluffy_Pillow 79.8/135: 59% energy | 5.0/5: 100% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong_oh(5), turbulent_vial_of_toxin
4:36.192 sinister_strike Fluffy_Pillow 94.4/135: 70% energy | 1.0/5: 20% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong_oh(5), turbulent_vial_of_toxin
4:36.997 sinister_strike Fluffy_Pillow 84.0/135: 62% energy | 3.0/5: 60% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong_oh(4), turbulent_vial_of_toxin
4:37.803 sinister_strike Fluffy_Pillow 88.4/135: 66% energy | 4.0/5: 80% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong_oh(4), turbulent_vial_of_toxin
4:38.607 eviscerate Fluffy_Pillow 77.8/135: 58% energy | 5.0/5: 100% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong_oh(3), turbulent_vial_of_toxin
4:39.414 sinister_strike Fluffy_Pillow 102.9/135: 76% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong_oh(3), turbulent_vial_of_toxin
4:40.419 sinister_strike Fluffy_Pillow 68.0/135: 50% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong_oh(3), turbulent_vial_of_toxin
4:41.425 vanish Fluffy_Pillow 33.1/135: 24% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong_oh(2), turbulent_vial_of_toxin
4:41.425 ambush Fluffy_Pillow 33.1/135: 24% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, stealth, vanish, slice_and_dice, exquisite_proficiency, mark_of_warsong_oh(2), turbulent_vial_of_toxin
4:42.430 eviscerate Fluffy_Pillow 78.0/135: 58% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong_oh(2), turbulent_vial_of_toxin
4:43.437 sinister_strike Fluffy_Pillow 82.9/135: 61% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong_oh, turbulent_vial_of_toxin
4:44.441 sinister_strike Fluffy_Pillow 62.7/135: 46% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong_oh, turbulent_vial_of_toxin
4:45.449 killing_spree Fluffy_Pillow 27.5/135: 20% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, turbulent_vial_of_toxin
4:48.784 sinister_strike Fluffy_Pillow 135.0/135: 100% energy | 5.0/5: 100% combo_points slice_and_dice, exquisite_proficiency, mark_of_warsong(10)
4:49.791 sinister_strike Fluffy_Pillow 101.1/135: 75% energy | 5.0/5: 100% combo_points bandits_guile, slice_and_dice, anticipation(2), exquisite_proficiency, mark_of_warsong(10)
4:50.796 sinister_strike Fluffy_Pillow 67.2/135: 50% energy | 5.0/5: 100% combo_points bandits_guile(2), slice_and_dice, anticipation(4), exquisite_proficiency, mark_of_warsong(9)
4:51.800 eviscerate Fluffy_Pillow 48.1/135: 36% energy | 5.0/5: 100% combo_points bandits_guile(3), slice_and_dice, anticipation(5), exquisite_proficiency, mark_of_warsong(9)
4:52.803 revealing_strike Fluffy_Pillow 54.0/135: 40% energy | 5.0/5: 100% combo_points bandits_guile(3), slice_and_dice, exquisite_proficiency, mark_of_warsong(8)
4:53.807 Waiting 0.400 sec 44.8/135: 33% energy | 5.0/5: 100% combo_points bandits_guile(3), slice_and_dice, anticipation, exquisite_proficiency, mark_of_warsong(8)
4:54.207 sinister_strike Fluffy_Pillow 51.1/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(3), slice_and_dice, anticipation, exquisite_proficiency, mark_of_warsong(8)
4:55.211 Waiting 0.624 sec 16.8/135: 12% energy | 5.0/5: 100% combo_points bandits_guile(4), shallow_insight, slice_and_dice, anticipation(2), exquisite_proficiency, mark_of_warsong(7)
4:55.835 slice_and_dice Fluffy_Pillow 26.6/135: 20% energy | 5.0/5: 100% combo_points bandits_guile(4), shallow_insight, slice_and_dice, anticipation(2), exquisite_proficiency, mark_of_warsong(7)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 1262 1202 1202
Agility 4114 3655 3546 (1253)
Stamina 4255 3869 3869
Intellect 746 711 711
Spirit 533 533 533
Health 255300 232140 0
Energy 135 135 0
Combo Points 5 5 0
Crit 25.66% 20.66% 623
Haste 16.03% 9.44% 836
Multistrike 8.12% 3.12% 206
Damage / Heal Versatility 7.78% 4.78% 622
Attack Power 6336 5117 0
Mastery 36.44% 26.44% 574
Armor 880 880 880

Talents

Level
15 Nightstalker Subterfuge Shadow Focus
30 Deadly Throw Nerve Strike Combat Readiness
45 Cheat Death Leeching Poison Elusiveness
60 Cloak and Dagger Shadowstep Burst of Speed
75 Prey on the Weak Internal Bleeding Dirty Tricks
90 Shuriken Toss Marked for Death Anticipation
100 Venom Rush Shadow Reflection Death from Above

Profile

rogue="Ralana"
origin="http://eu.battle.net/wow/en/character/forscherliga/Ralana/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/114/47730546-avatar.jpg"
level=100
race=night_elf
role=attack
position=back
professions=engineering=659/jewelcrafting=659
talents=http://eu.battle.net/wow/en/tool/talent-calculator#cZ!2221020
glyphs=energy/feint/disappearance/poisons/safe_fall/decoy
spec=combat

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_agility_flask
actions.precombat+=/food,type=frosty_stew
actions.precombat+=/apply_poison,lethal=deadly
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=draenic_agility
actions.precombat+=/stealth
actions.precombat+=/marked_for_death
actions.precombat+=/slice_and_dice,if=talent.marked_for_death.enabled

# Executed every time the actor is available.

actions=potion,name=draenic_agility,if=buff.bloodlust.react|target.time_to_die<40|(buff.adrenaline_rush.up&(trinket.proc.any.react|trinket.stacking_proc.any.react|buff.archmages_greater_incandescence_agi.react))
actions+=/kick
actions+=/preparation,if=!buff.vanish.up&cooldown.vanish.remains>30
actions+=/use_item,slot=trinket1
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent,if=energy<60
actions+=/blade_flurry,if=(active_enemies>=2&!buff.blade_flurry.up)|(active_enemies<2&buff.blade_flurry.up)
actions+=/shadow_reflection,if=(cooldown.killing_spree.remains<10&combo_points>3)|buff.adrenaline_rush.up
actions+=/ambush
actions+=/vanish,if=time>10&(combo_points<3|(talent.anticipation.enabled&anticipation_charges<3)|(combo_points<4|(talent.anticipation.enabled&anticipation_charges<4)))&((talent.shadow_focus.enabled&buff.adrenaline_rush.down&energy<90&energy>=15)|(talent.subterfuge.enabled&energy>=90)|(!talent.shadow_focus.enabled&!talent.subterfuge.enabled&energy>=60))
actions+=/slice_and_dice,if=buff.slice_and_dice.remains<2|((target.time_to_die>45&combo_points=5&buff.slice_and_dice.remains<12)&buff.deep_insight.down)
actions+=/call_action_list,name=adrenaline_rush,if=(energy<35|buff.bloodlust.up)&cooldown.killing_spree.remains>10
actions+=/call_action_list,name=killing_spree,if=(energy<40|(buff.bloodlust.up&time<10)|buff.bloodlust.remains>20)&buff.adrenaline_rush.down&(!talent.shadow_reflection.enabled|cooldown.shadow_reflection.remains>30|buff.shadow_reflection.remains>3)
actions+=/marked_for_death,if=combo_points<=1&dot.revealing_strike.ticking&(!talent.shadow_reflection.enabled|buff.shadow_reflection.up|cooldown.shadow_reflection.remains>30)
actions+=/call_action_list,name=generator,if=combo_points<5|!dot.revealing_strike.ticking|(talent.anticipation.enabled&anticipation_charges<=4&buff.deep_insight.down)
actions+=/call_action_list,name=finisher,if=combo_points=5&dot.revealing_strike.ticking&(buff.deep_insight.up|!talent.anticipation.enabled|(talent.anticipation.enabled&anticipation_charges>=4))

actions.adrenaline_rush=adrenaline_rush,if=time_to_die>=44
actions.adrenaline_rush+=/adrenaline_rush,if=time_to_die<44&(buff.archmages_greater_incandescence_agi.react|trinket.proc.any.react|trinket.stacking_proc.any.react)
actions.adrenaline_rush+=/adrenaline_rush,if=time_to_die<=buff.adrenaline_rush.duration*1.5

actions.killing_spree=killing_spree,if=time_to_die>=44
actions.killing_spree+=/killing_spree,if=time_to_die<44&buff.archmages_greater_incandescence_agi.react&buff.archmages_greater_incandescence_agi.remains>=buff.killing_spree.duration
actions.killing_spree+=/killing_spree,if=time_to_die<44&trinket.proc.any.react&trinket.proc.any.remains>=buff.killing_spree.duration
actions.killing_spree+=/killing_spree,if=time_to_die<44&trinket.stacking_proc.any.react&trinket.stacking_proc.any.remains>=buff.killing_spree.duration
actions.killing_spree+=/killing_spree,if=time_to_die<=buff.killing_spree.duration*1.5

# Combo point generators

actions.generator=revealing_strike,if=(combo_points=4&dot.revealing_strike.remains<7.2&(target.time_to_die>dot.revealing_strike.remains+7.2)|(target.time_to_die<dot.revealing_strike.remains+7.2&ticks_remain<2))|!ticking
actions.generator+=/sinister_strike,if=dot.revealing_strike.ticking

# Combo point finishers

actions.finisher=death_from_above
actions.finisher+=/eviscerate

head=nightvision_mechshades,id=109171,bonus_id=179/525/531
neck=shifting_taladite_pendant,id=115800,bonus_id=204/525/540,enchant=40haste
shoulders=spaulders_of_burning_focus,id=109934,bonus_id=524
back=cloak_of_creeping_necrosis,id=113657,bonus_id=566,enchant=gift_of_haste
chest=bloodfeather_chestwrap,id=109885,bonus_id=524
shirt=precious_ribbon,id=52019
tabard=stormwind_tabard,id=118365
wrists=bracers_of_spare_skin,id=113634
hands=treacherous_palms,id=113832,bonus_id=43/566
waist=bloodfeather_girdle,id=109830,bonus_id=524
legs=leafmender_legwraps,id=109812,bonus_id=524
feet=sandals_of_mycoid_musing,id=113664,bonus_id=566
finger1=spellsink_signet,id=113843,bonus_id=566,enchant=50haste
finger2=timeless_solium_band_of_the_assassin,id=118297,enchant=50haste
trinket1=turbulent_vial_of_toxin,id=114488,bonus_id=560
trinket2=voidtouched_totem,id=114891
main_hand=the_bladefist,id=113591,bonus_id=41/566,enchant=mark_of_warsong
off_hand=the_bladefist,id=113591,bonus_id=566,enchant=mark_of_warsong

# Gear Summary
# gear_agility=2194
# gear_stamina=2979
# gear_crit_rating=623
# gear_haste_rating=796
# gear_mastery_rating=574
# gear_armor=880
# gear_multistrike_rating=206
# gear_versatility_rating=622
# gear_leech_rating=59

Mîrai

Mîrai : 26924 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
26924.1 26924.1 10.2 / 0.038% 3156.8 / 11.7% 1241.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
20.4 20.4 Energy 41.81% 41.9 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Mîrai/advanced
Talents
  • 15: Subterfuge
  • 30: Nerve Strike
  • 45: Cheat Death
  • 60: Shadowstep
  • 75: Prey on the Weak
  • 90: Anticipation
  • 100: Shadow Reflection
  • Talent Calculator
Glyphs
  • Glyph of Hemorrhaging Veins
  • Glyph of Cloak of Shadows
  • Glyph of Energy
  • Glyph of Poisons
  • Glyph of Safe Fall
Professions
  • leatherworking: 700
  • jewelcrafting: 700

Charts

http://9.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=M%C3%AErai+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x240&chd=t:81211|42819|29818|12829|10774|5139|2470&chds=0,162422&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++81211++rupture,C79C6E,0,0,15|t++42819++eviscerate,C79C6E,1,0,15|t++29818++ambush,C79C6E,2,0,15|t++12829++garrote,C79C6E,3,0,15|t++10774++backstab,C79C6E,4,0,15|t++5139++auto_attack_mh,C79C6E,5,0,15|t++2470++auto_attack_oh,C79C6E,6,0,15& http://0.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=M%C3%AErai+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:20,19,18,12,12,10,4,4,3,2,2,1,0,0&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ABD473,ABD473,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=auto_attack_mh|eviscerate|rupture|ambush|backstab|auto_attack_oh|deadly_poison_instant|deadly_poison_dot|shadow_reflection: ambush|shadow_reflection: rupture|shattered_bleed|shadow_reflection: eviscerate|garrote|shadow_reflection: backstab&
http://2.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=M%C3%AErai+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:dimqtw0357864421yyusromjigdcbaZZZZZZaZaZZZZYXXXXWWWWWWWVWVVVUUUUVVWVWWWWWVVVUUTTTTSRRRQQQPPPPPPOOOOOOOOOOOOOPPPPQSTVXYacegjlmnprrstttqponnnlkkhgeddbbaZZYYYYXWVUTSRRQQPPOOOOOPQQRRSSTUUVWWXXYYYZYYXWWVUUTSSRQQPPPOOOOOOOOPPPPPPPPPPPQQQQRSSTTUUVWWXYZabcdeefgghhhijjjjjjihggeedbaZYXWUTSRRQPPPPPPPPPPPQQQQQQRRRRRSSSSTTTTTUUUUUVVVUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUVUTSRQPONMK&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.419358,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=26924|max=64203&chxp=1,1,42,100 http://5.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=M%C3%AErai+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,0,4,21,14,51,67,111,186,261,362,505,628,780,931,1117,1196,1248,1374,1344,1422,1404,1305,1317,1218,1212,1062,946,867,801,662,558,437,404,305,253,194,153,109,58,36,30,23,10,5,4,2,1,0,1&chds=0,1422&chbh=5&chxt=x&chxl=0:|min=24283|avg=26924|max=30289&chxp=0,1,44,100& http://1.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=M%C3%AErai+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:27.6,11.2,10.3,5.7,2.6,0.4,0.3,41.8&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ffffff&chl=backstab 83.0s|eviscerate 33.7s|ambush 31.1s|rupture 17.2s|slice_and_dice 7.9s|preparation 1.2s|garrote 1.0s|waiting 125.8s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% M-Count M-Hit M-Crit M-Crit% Up%
Mîrai 26924
ambush 3097 11.5% 31.0 9.50sec 29951 29818 Direct 31.0 19959 42941 26040 26.5% 0.0% 14.1 6598 14026 26.5%  

Stats details: ambush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.97 30.97 0.00 0.00 1.0045 0.0000 927715.22 1004811.87 7.67 29817.61 29817.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.75 26.49% 14026.24 8999 19016 13706.96 0 19016 52551 52551 0.00
multistrike 10.40 73.51% 6597.83 4411 9321 6606.55 0 9321 68587 68587 0.00
hit 22.78 73.54% 19958.64 9568 31071 19982.16 16582 24283 454622 500341 9.15
crit 8.20 26.46% 42940.52 19519 63386 43050.78 0 63386 351954 383332 8.25
 
DPS Timeline Chart
 

Action details: ambush

Static Values
  • id:8676
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5|(talent.anticipation.enabled&anticipation_charges<3)&(time<1.2|buff.shadow_dance.up|time>5)
Spelldata
  • id:8676
  • name:Ambush
  • school:physical
  • tooltip:
  • description:Ambush the target, causing $sw2 Physical damage to the target (damage increased 40% if a dagger is equipped){$?s138106=false}[ and causes you to appear behind the target][]. Awards {$s3=2} combo $lpoint:points;.{$?s91023=false}[ For the next {$91021d=10 seconds}, your attacks bypass up to {$91021s1=100}% of that enemy's armor.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.11
 
auto_attack_mh 5110 19.0% 314.2 0.96sec 4882 5139 Direct 314.2 3939 8558 4318 24.4% 19.0% 116.3 1188 2569 24.4%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 314.24 314.24 0.00 0.00 0.9500 0.0000 1534284.85 1819037.22 15.65 5139.31 5139.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 28.40 24.41% 2568.85 1412 4600 2572.81 1890 3682 72945 85317 14.54
multistrike 87.92 75.59% 1187.65 692 2255 1189.02 1017 1413 104415 125045 16.49
hit 177.78 56.58% 3939.46 2307 7516 3943.61 3576 4315 700368 840392 16.64
crit 76.72 24.41% 8557.76 4706 15332 8572.51 7230 10171 656557 768283 14.52
miss 59.74 19.01% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 2456 9.1% 311.5 0.97sec 2367 2470 Direct 311.5 1908 4153 2093 24.4% 19.0% 115.3 576 1245 24.4%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 311.54 311.54 0.00 0.00 0.9583 0.0000 737399.05 874357.25 15.66 2469.99 2469.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 28.17 24.43% 1244.69 682 2250 1246.82 908 1662 35064 41051 14.62
multistrike 87.15 75.57% 575.61 335 1103 576.30 495 680 50167 60076 16.49
hit 176.30 56.59% 1908.43 1115 3677 1910.55 1738 2112 336459 403790 16.66
crit 76.02 24.40% 4153.03 2275 7501 4160.10 3523 4822 315709 369440 14.53
miss 59.22 19.01% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
backstab 2973 11.1% 82.6 3.48sec 10823 10774 Direct 82.6 7509 16072 9518 23.5% 0.0% 37.8 2251 4821 23.4%  

Stats details: backstab

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.60 82.60 0.00 0.00 1.0045 0.0000 893962.06 1112392.05 19.64 10774.13 10774.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 8.84 23.41% 4820.77 2921 8248 4827.90 0 8248 42615 52276 18.66
multistrike 28.92 76.59% 2251.41 1432 4043 2253.17 1718 2991 65120 81828 20.44
hit 63.22 76.54% 7509.48 4773 13477 7515.04 6702 8300 474769 596340 20.36
crit 19.38 23.46% 16071.85 9737 27493 16099.51 11685 21912 311458 381947 18.47
 
DPS Timeline Chart
 

Action details: backstab

Static Values
  • id:53
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Backstab the target, causing $sw2 Physical damage. Must not be in front of the target. Awards {$s3=1} combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.17
 
deadly_poison_dot 930 3.5% 196.3 1.53sec 1425 0 Periodic 99.5 1945 4120 2472 24.2% 0.0% 45.5 584 1235 24.2% 99.1%

Stats details: deadly_poison_dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 196.27 196.27 99.46 99.46 0.0000 3.0000 279644.82 279644.82 0.00 937.24 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 196.27 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 11.0 24.23% 1235.31 886 2003 1236.91 0 1829 13625 13625 0.00
multistrike 34.5 75.77% 583.55 434 982 584.03 516 685 20128 20128 0.00
hit 75.3 75.76% 1945.01 31 3273 1946.51 1819 2083 146549 146549 0.00
crit 24.1 24.24% 4120.18 659 6678 4126.24 3536 4983 99343 99343 0.00
 
DPS Timeline Chart
 

Action details: deadly_poison_dot

Static Values
  • id:2818
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2818
  • name:Deadly Poison
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 seconds.
  • description:{$@spelldesc2823=Coats your weapons with a Lethal Poison that lasts for {$2823d=3600 seconds}. Each strike has a {$2823h=30}% chance of poisoning the enemy for ${$2818m1*4} Nature damage over {$2818d=12 seconds}. Subsequent poison applications will instantly deal {$113780s1=0} Nature damage.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.250140
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:12.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
deadly_poison_instant 952 3.5% 195.3 1.53sec 1464 0 Direct 195.3 1011 2148 1288 24.3% 0.0% 89.1 303 644 24.4%  

Stats details: deadly_poison_instant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 195.27 195.27 0.00 0.00 0.0000 0.0000 285920.69 285920.69 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 21.74 24.40% 644.50 456 1031 645.26 538 843 14010 14010 0.00
multistrike 67.36 75.60% 303.29 223 505 303.56 275 348 20429 20429 0.00
hit 147.73 75.66% 1010.97 745 1684 1011.85 947 1098 149355 149355 0.00
crit 47.54 24.34% 2148.42 1519 3436 2151.19 1882 2486 102127 102127 0.00
 
DPS Timeline Chart
 

Action details: deadly_poison_instant

Static Values
  • id:113780
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113780
  • name:Deadly Poison
  • school:nature
  • tooltip:
  • description:Poisoned weapons have a chance to deal {$s1=0} Nature damage to a target already affected by Deadly Poison.
 
eviscerate 4806 17.9% 33.6 8.82sec 43011 42819 Direct 33.6 29348 64022 37818 24.4% 0.0% 15.3 8801 19220 24.5%  

Stats details: eviscerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.55 33.55 0.00 0.00 1.0045 0.0000 1443162.85 1651982.48 12.64 42818.74 42818.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.76 24.48% 19220.38 11318 35551 18830.25 0 35551 72226 81681 11.99
multistrike 11.59 75.52% 8800.59 5548 17427 8807.61 5548 14930 101996 117766 13.55
hit 25.36 75.57% 29347.98 18494 58090 29362.22 23444 35164 744173 859109 13.40
crit 8.20 24.43% 64022.22 37727 118504 64225.73 0 118504 524768 593426 11.76
 
DPS Timeline Chart
 

Action details: eviscerate

Static Values
  • id:2098
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2098
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that causes damage per combo point: 1 point : ${($AP*0.577)*$<mult>} damage 2 points: ${($AP*0.577)*$<mult>*2} damage 3 points: ${($AP*0.577)*$<mult>*3} damage 4 points: ${($AP*0.577)*$<mult>*4} damage 5 points: ${($AP*0.577)*$<mult>*5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.507760
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00
 
garrote 44 0.2% 1.0 0.00sec 12884 12829 Periodic 9.0 936 1916 1259 33.0% 0.0% 4.1 281 574 32.8% 6.0%

Stats details: garrote

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 9.00 9.00 1.0045 2.0000 12879.85 12879.85 0.00 677.96 12828.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.3 32.77% 574.38 481 626 433.52 0 626 774 774 0.00
multistrike 2.8 67.23% 280.72 236 307 266.03 0 307 776 776 0.00
hit 6.0 67.00% 935.85 786 1022 935.46 0 1022 5641 5641 0.00
crit 3.0 33.00% 1915.69 1603 2085 1856.32 0 2085 5688 5688 0.00
 
DPS Timeline Chart
 

Action details: garrote

Static Values
  • id:703
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:45.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking&time<1
Spelldata
  • id:703
  • name:Garrote
  • school:physical
  • tooltip:$w1 damage every $t1 seconds.
  • description:Garrote the enemy, silencing them for {$1330d=3 seconds} and causing $o1 damage over {$d=18 seconds}. Awards {$s3=1} combo $lpoint:points;{$?s138106=false}[ and causes you to appear behind the target][].{$?s91023=false}[ For the next {$91021d=10 seconds}, your attacks bypass up to {$91021s1=100}% of that enemy's armor.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.078000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
 
rupture 4638 17.2% 17.1 17.93sec 81572 81211 Periodic 197.0 4896 10377 6223 24.2% 0.0% 90.0 1469 3114 24.2% 130.9%

Stats details: rupture

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.09 17.09 197.03 197.03 1.0045 2.0000 1394146.57 1394146.57 0.00 3390.20 81210.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.09 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 21.8 24.22% 3113.93 2581 5276 3117.75 2621 4132 67875 67875 0.00
multistrike 68.2 75.78% 1468.52 1265 2586 1469.70 1341 1651 100164 100164 0.00
hit 149.3 75.79% 4895.75 4218 8620 4899.45 4648 5212 731063 731063 0.00
crit 47.7 24.21% 10377.37 8604 17586 10390.12 9188 11926 495045 495045 0.00
 
DPS Timeline Chart
 

Action details: rupture

Static Values
  • id:1943
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<duration*0.3)&active_enemies<=3&(cooldown.death_from_above.remains>0|!talent.death_from_above.enabled)
Spelldata
  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that causes damage over time. Lasts longer per combo point: 1 point : ${$<bonus>*1*0.0685*$AP*0.5*8} over 8 sec 2 points: ${$<bonus>*2*0.0685*$AP*0.5*12} over 12 sec 3 points: ${$<bonus>*3*0.0685*$AP*0.5*16} over 16 sec 4 points: ${$<bonus>*4*0.0685*$AP*0.5*20} over 20 sec 5 points: ${$<bonus>*5*0.0685*$AP*0.5*24} over 24 sec{$?s79134=false}[ While you have poisoned your target, this damage deals {$79136s1=0} additional Nature damage and grants you {$79134s2=10} Energy. You gain additional Energy if a target dies with Rupture active.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.068500
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
shattered_bleed 413 1.5% 16.7 18.35sec 7414 0 Direct 16.7 1662 3395 2082 24.2% 0.0% 7.7 499 1018 24.2%  
Periodic 93.1 797 0 797 0.0% 0.0% 42.5 242 0 0.0% 30.9%

Stats details: shattered_bleed

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.74 16.74 93.07 93.07 0.0000 1.0000 124076.33 124076.33 0.00 1333.12 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.85 24.16% 1018.25 986 1134 855.06 0 1134 1884 1884 0.00
multistrike 5.81 75.84% 498.64 484 556 496.88 0 556 2897 2897 0.00
hit 12.68 75.77% 1662.23 1612 1854 1663.00 1612 1819 21078 21078 0.00
crit 4.05 24.23% 3394.86 3288 3782 3341.89 0 3782 13766 13766 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike 42.5 100.00% 241.79 242 242 241.79 242 242 10285 10285 0.00
hit 93.1 100.00% 796.88 0 806 797.15 768 806 74167 74167 0.00
 
DPS Timeline Chart
 

Action details: shattered_bleed

Static Values
  • id:159238
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:159238
  • name:Shattered Bleed
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2.
  • description:Inflicts {$s1=1500} Bleed damage, plus an additional $o2 damage over {$d=6 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1499.91
  • base_dd_max:1499.91
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:749.87
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - shadow_reflection 10076 / 1506
ambush 4334 2.4% 10.6 24.05sec 18384 0 Direct 10.6 12185 24656 16167 31.9% 0.0% 4.8 3656 7393 32.0%  

Stats details: ambush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.56 10.56 0.00 0.00 0.0000 0.0000 194167.34 298404.54 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.54 31.95% 7392.88 6444 7654 5851.48 0 7654 11404 17527 27.61
multistrike 3.28 68.05% 3655.66 3222 3827 3542.63 0 3827 12009 18455 33.76
hit 7.19 68.07% 12185.07 10740 12756 12219.87 0 12756 87601 134628 34.93
crit 3.37 31.93% 24655.65 21479 25512 24267.76 0 25512 83154 127794 34.29
 
DPS Timeline Chart
 

Action details: ambush

Static Values
  • id:8676
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8676
  • name:Ambush
  • school:physical
  • tooltip:
  • description:Ambush the target, causing $sw2 Physical damage to the target (damage increased 40% if a dagger is equipped){$?s138106=false}[ and causes you to appear behind the target][]. Awards {$s3=2} combo $lpoint:points;.{$?s91023=false}[ For the next {$91021d=10 seconds}, your attacks bypass up to {$91021s1=100}% of that enemy's armor.][]
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.11
 
backstab 19 0.0% 0.1 67.99sec 8798 0 Direct 0.1 5894 11966 7736 30.3% 0.0% 0.0 1767 3585 28.8%  

Stats details: backstab

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.10 0.10 0.00 0.00 0.0000 0.0000 874.51 1343.99 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.01 28.82% 3585.17 3214 3818 46.17 0 3818 48 73 0.45
multistrike 0.03 71.18% 1766.52 1607 1909 52.20 0 1909 58 89 1.03
hit 0.07 69.66% 5893.59 5357 6363 393.51 0 6363 408 627 2.33
crit 0.03 30.34% 11965.77 10715 12726 358.20 0 12726 361 555 1.05
 
DPS Timeline Chart
 

Action details: backstab

Static Values
  • id:53
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Backstab the target, causing $sw2 Physical damage. Must not be in front of the target. Awards {$s3=1} combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.17
 
eviscerate 2552 1.4% 2.9 98.67sec 39660 0 Direct 2.9 26322 53424 34871 31.5% 0.0% 1.3 7898 16042 31.4%  

Stats details: eviscerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.87 2.87 0.00 0.00 0.0000 0.0000 114006.96 175210.69 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.41 31.41% 16041.70 13397 17256 5556.02 0 17256 6634 10195 12.09
multistrike 0.90 68.59% 7898.36 6698 8628 4789.76 0 8628 7131 10959 21.11
hit 1.97 68.46% 26322.43 22328 28760 24792.81 0 28760 51800 79608 32.72
crit 0.91 31.54% 53424.03 44655 57519 34926.90 0 57519 48443 74449 22.77
 
DPS Timeline Chart
 

Action details: eviscerate

Static Values
  • id:2098
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2098
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that causes damage per combo point: 1 point : ${($AP*0.577)*$<mult>} damage 2 points: ${($AP*0.577)*$<mult>*2} damage 3 points: ${($AP*0.577)*$<mult>*3} damage 4 points: ${($AP*0.577)*$<mult>*4} damage 5 points: ${($AP*0.577)*$<mult>*5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.577000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
rupture 3171 1.8% 2.1 145.22sec 68437 0 Periodic 24.1 4041 8495 5164 25.2% 0.0% 11.0 1211 2548 25.1% 16.0%

Stats details: rupture

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.07 2.07 24.14 24.14 0.0000 2.0000 141723.84 141723.84 0.00 2936.06 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.07 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.8 25.11% 2548.48 1949 3463 2343.05 0 3463 7067 7067 0.00
multistrike 8.3 74.89% 1211.40 974 1732 1211.68 0 1732 10022 10022 0.00
hit 18.0 74.78% 4040.56 3248 5772 4049.93 0 5085 72922 72922 0.00
crit 6.1 25.22% 8494.52 6495 11544 8509.13 0 11544 51713 51713 0.00
 
DPS Timeline Chart
 

Action details: rupture

Static Values
  • id:1943
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that causes damage over time. Lasts longer per combo point: 1 point : ${$<bonus>*1*0.0685*$AP*0.5*8} over 8 sec 2 points: ${$<bonus>*2*0.0685*$AP*0.5*12} over 12 sec 3 points: ${$<bonus>*3*0.0685*$AP*0.5*16} over 16 sec 4 points: ${$<bonus>*4*0.0685*$AP*0.5*20} over 20 sec 5 points: ${$<bonus>*5*0.0685*$AP*0.5*24} over 24 sec{$?s79134=false}[ While you have poisoned your target, this damage deals {$79136s1=0} additional Nature damage and grants you {$79134s2=10} Energy. You gain additional Energy if a target dies with Rupture active.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.068500
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Simple Action Stats Execute Interval
Mîrai
draenic_agility_potion 2.0 0.00sec

Stats details: draenic_agility_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156423
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156423
  • name:Draenic Agility Potion
  • school:physical
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
 
kick 8.4 37.57sec

Stats details: kick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.41 8.41 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.41 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: kick

Static Values
  • id:1766
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:1766
  • name:Kick
  • school:physical
  • tooltip:
  • description:A quick kick that interrupts spellcasting and prevents any spell in that school from being cast for {$d=5 seconds}.{$?s56805=false}[ If you successfully interrupt a spell, Kick's cooldown is reduced by ${$56805m2/1000} sec.][]
 
premeditation 8.8 37.11sec

Stats details: premeditation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.77 8.77 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 8.77 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: premeditation

Static Values
  • id:14183
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:combo_points<=4&!(buff.shadow_dance.up&energy>100&combo_points>1)&!buff.subterfuge.up|(buff.subterfuge.up&debuff.find_weakness.up)
Spelldata
  • id:14183
  • name:Premeditation
  • school:physical
  • tooltip:
  • description:Adds {$s1=2} combo points. You must add to or use those combo points within {$d=18 seconds} or the combo points are lost.
 
preparation 1.2 313.02sec

Stats details: preparation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.15 1.15 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 1.15 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: preparation

Static Values
  • id:14185
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.vanish.up&cooldown.vanish.remains>60
Spelldata
  • id:14185
  • name:Preparation
  • school:physical
  • tooltip:
  • description:Immediately resets the cooldown on your Sprint, Vanish, and Evasion.
 
shadow_dance 5.3 61.81sec

Stats details: shadow_dance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.31 5.31 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 5.31 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: shadow_dance

Static Values
  • id:51713
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:energy>=50&buff.stealth.down&buff.vanish.down&debuff.find_weakness.down|(buff.bloodlust.up&(dot.hemorrhage.ticking|dot.garrote.ticking|dot.rupture.ticking))
Spelldata
  • id:51713
  • name:Shadow Dance
  • school:physical
  • tooltip:Can use opening abilities without being stealthed. Energy cost of Ambush reduced by {$s2=20}.
  • description:Enter the Shadow Dance for {$d=8 seconds}, allowing the use of abilities that ordinarily require Stealth, and reducing the Energy cost of Ambush by {$s2=20}.
 
shadow_reflection 2.9 124.05sec

Stats details: shadow_reflection

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.88 2.88 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 2.88 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: shadow_reflection

Static Values
  • id:152151
  • school:physical
  • resource:none
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.shadow_dance.up
Spelldata
  • id:152151
  • name:Shadow Reflection
  • school:physical
  • tooltip:You have a Shadow Reflection, watching you and replicating your abilities used.
  • description:Summon a shadow of yourself on the target that will watch you and memorize your offensive ability usage for the next 8 sec. After this time, it will mimic the memorized abilities on its target over the next 8 sec.
 
slice_and_dice 8.8 36.21sec

Stats details: slice_and_dice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.83 8.83 0.00 0.00 0.8907 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 8.83 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: slice_and_dice

Static Values
  • id:5171
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:5171
  • name:Slice and Dice
  • school:physical
  • tooltip:Attack speed increased by $w1%.$?$w2!=0[ Regaining $w2 Energy every $t2 sec.][]
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=40}%{$?s79152=false}[ and grant {$79152s1=8} Energy per $5171t2 sec][]. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds
 
vanish 4.2 72.45sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.17 4.17 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 4.17 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.shadow_focus.enabled&energy>=45&energy<=75&combo_points<=3&buff.shadow_dance.down&buff.master_of_subtlety.down&debuff.find_weakness.down
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering an improved stealth mode for {$11327d=3 seconds}. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
anticipation 34.9 38.8 8.6sec 4.0sec 33.99% 34.00% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_anticipation
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • anticipation_1:12.68%
  • anticipation_2:6.14%
  • anticipation_3:5.62%
  • anticipation_4:5.81%
  • anticipation_5:3.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:115189
  • name:Anticipation
  • tooltip:Your next offensive finishing move will grant you {$s1=1} combo points on that target.
  • description:{$@spelldesc114015=When one of your attacks generates a combo point while you already have 5 combo points, you gain an Anticipation charge. Performing an offensive finishing move consumes all Anticipation charges and grants you a combo point for each.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 27.14% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
draenic_agility_potion 2.0 0.0 123.2sec 0.0sec 15.21% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_draenic_agility_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:1000.00

Stack Uptimes

  • draenic_agility_potion_1:15.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156423
  • name:Draenic Agility Potion
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
lucky_flip 2.9 0.0 124.1sec 124.1sec 18.63% 18.64% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_lucky_flip
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:1467.00

Stack Uptimes

  • lucky_flip_1:18.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:177597
  • name:"Lucky" Flip
  • tooltip:Increases Agility by {$s1=870}.
  • description:Increases your Agility by {$s1=870} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
mark_of_bleeding_hollow 8.9 5.0 35.4sec 21.9sec 43.84% 43.85% 5.0(5.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_mark_of_bleeding_hollow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:mastery_rating
  • amount:500.00

Stack Uptimes

  • mark_of_bleeding_hollow_1:43.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173322
  • name:Mark of Bleeding Hollow
  • tooltip:Mastery increased by $w1.
  • description:Mastery increased by {$s1=500}.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
master_of_subtlety 5.1 0.0 61.1sec 61.1sec 10.13% 10.15% 5.0(5.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_master_of_subtlety
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • master_of_subtlety_1:10.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31666
  • name:Master of Subtlety
  • tooltip:
  • description:
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
master_of_subtlety_passive (_passive) 5.2 0.0 61.3sec 72.5sec 5.15% 5.17% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_master_of_subtlety_passive
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • master_of_subtlety_passive_1:5.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31223
  • name:Master of Subtlety
  • tooltip:
  • description:Attacks made while stealthed and for 6 seconds after breaking stealth cause an additional {$s1=10}% damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
shadow_dance 5.3 0.0 61.8sec 61.8sec 17.37% 17.38% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_dance_1:17.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:51713
  • name:Shadow Dance
  • tooltip:Can use opening abilities without being stealthed. Energy cost of Ambush reduced by {$s2=20}.
  • description:Enter the Shadow Dance for {$d=8 seconds}, allowing the use of abilities that ordinarily require Stealth, and reducing the Energy cost of Ambush by {$s2=20}.
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
shadow_reflection 2.9 0.0 124.1sec 124.1sec 15.01% 15.02% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_shadow_reflection
  • max_stacks:1
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_reflection_1:15.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:152151
  • name:Shadow Reflection
  • tooltip:You have a Shadow Reflection, watching you and replicating your abilities used.
  • description:Summon a shadow of yourself on the target that will watch you and memorize your offensive ability usage for the next 8 sec. After this time, it will mimic the memorized abilities on its target over the next 8 sec.
  • max_stacks:0
  • duration:16.00
  • cooldown:120.00
  • default_chance:100.00%
slice_and_dice 2.4 6.4 112.0sec 36.2sec 99.71% 100.00% 155.9(155.9)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • slice_and_dice_1:99.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5171
  • name:Slice and Dice
  • tooltip:Attack speed increased by $w1%.$?$w2!=0[ Regaining $w2 Energy every $t2 sec.][]
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=40}%{$?s79152=false}[ and grant {$79152s1=8} Energy per $5171t2 sec][]. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
spirit_of_the_warlords 3.1 0.0 117.9sec 117.9sec 19.72% 19.74% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_spirit_of_the_warlords
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:crit_rating
  • amount:1396.00

Stack Uptimes

  • spirit_of_the_warlords_1:19.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162915
  • name:Spirit of the Warlords
  • tooltip:Critical strike increased by {$s1=1044}.
  • description:Critical strike increased by {$s1=1044} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
stealth 5.2 0.0 61.3sec 72.5sec 5.15% 5.17% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:0.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stealth_1:5.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}%. ]?s13975[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%. ][]{$?s31223=false}[Attacks from Stealth and for {$31666d=6 seconds} after deal {$31223s1=10}% more damage. ][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:6.00
  • default_chance:100.00%
subterfuge 5.2 0.0 61.3sec 72.5sec 5.15% 5.17% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_subterfuge
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • subterfuge_1:5.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:115192
  • name:Subterfuge
  • tooltip:Temporarily concealed in the shadows.
  • description:Your Stealth breaks {$d=3 seconds} after dealing or receiving damage, rather than immediately.
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
vanish 4.2 0.0 72.5sec 72.5sec 4.14% 4.15% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • vanish_1:4.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_agility_flask

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_greater_draenic_agility_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:250.00

Stack Uptimes

  • greater_draenic_agility_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156064
  • name:Greater Draenic Agility Flask
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Mîrai
ambush Energy 31.0 1413.8 45.6 45.6 656.2
backstab Energy 82.6 2891.1 35.0 35.0 309.2
eviscerate Energy 33.6 1174.4 35.0 35.0 1228.9
eviscerate Combo Points 33.6 167.8 5.0 5.0 8602.2
garrote Energy 1.0 45.0 45.0 45.0 286.3
rupture Energy 17.1 427.3 25.0 25.0 3262.9
rupture Combo Points 17.1 85.5 5.0 5.0 16314.4
slice_and_dice Energy 8.8 195.8 22.2 22.2 0.0
slice_and_dice Combo Points 8.8 44.2 5.0 5.0 0.0
Resource Gains Type Count Total Average Overflow
garrote Combo Points 1.00 1.00 (0.34%) 1.00 0.00 0.00%
ambush Combo Points 36.27 61.91 (20.86%) 1.71 0.00 0.00%
backstab Combo Points 82.60 82.60 (27.83%) 1.00 0.00 0.00%
energy_regen Energy 824.18 3393.99 (56.08%) 4.12 0.00 0.00%
external_healing Health 8.20 0.00 (0.00%) 0.00 77277.04 100.00%
energetic_recovery Energy 149.54 1196.33 (19.77%) 8.00 0.00 0.00%
honor_among_thieves Combo Points 135.61 135.61 (45.69%) 1.00 0.00 0.00%
premeditation Combo Points 8.58 15.70 (5.29%) 1.83 0.00 0.00%
relentless_strikes Energy 59.48 1461.88 (24.15%) 24.58 25.00 1.68%
Resource RPS-Gain RPS-Loss
Energy 20.11 20.43
Combo Points 0.98 0.99
Combat End Resource Mean Min Max
Energy 24.57 0.00 97.22
Combo Points 3.57 0.00 5.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.0%
shadow_reflection-Energy Cap 0.0%

Procs

Count Interval
Anticipation Charges (wasted) 0.7 75.2sec
Honor Among Thieves (Proxy action) 136.3 2.2sec

Statistics & Data Analysis

Fight Length
Sample Data Mîrai Fight Length
Count 25000
Mean 300.94
Minimum 230.43
Maximum 374.11
Spread ( max - min ) 143.68
Range [ ( max - min ) / 2 * 100% ] 23.87%
DPS
Sample Data Mîrai Damage Per Second
Count 25000
Mean 26924.05
Minimum 24283.10
Maximum 30289.14
Spread ( max - min ) 6006.04
Range [ ( max - min ) / 2 * 100% ] 11.15%
Standard Deviation 820.5317
5th Percentile 25652.25
95th Percentile 28344.09
( 95th Percentile - 5th Percentile ) 2691.84
Mean Distribution
Standard Deviation 5.1895
95.00% Confidence Intervall ( 26913.88 - 26934.22 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 35
0.1% Error 3567
0.1 Scale Factor Error with Delta=300 5747
0.05 Scale Factor Error with Delta=300 22989
0.01 Scale Factor Error with Delta=300 574743
Distribution Chart
DPS(e)
Sample Data Mîrai Damage Per Second (Effective)
Count 25000
Mean 26924.05
Minimum 24283.10
Maximum 30289.14
Spread ( max - min ) 6006.04
Range [ ( max - min ) / 2 * 100% ] 11.15%
Damage
Sample Data Mîrai Damage
Count 25000
Mean 7633192.30
Minimum 5581643.98
Maximum 9632231.36
Spread ( max - min ) 4050587.38
Range [ ( max - min ) / 2 * 100% ] 26.53%
DTPS
Sample Data Mîrai Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Mîrai Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Mîrai Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Mîrai Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Mîrai Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Mîrai Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data MîraiTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Mîrai Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_agility_flask
1 0.00 food,type=calamari_crepes
2 0.00 apply_poison,lethal=deadly
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=draenic_agility
5 0.00 stealth
6 0.00 slice_and_dice
7 0.00 honor_among_thieves,cooldown=2.2,cooldown_stddev=0.1
Proxy Honor Among Thieves action. Generates Combo Points at a mean rate of 2.2 seconds. Comment out to disable (and use the real Honor Among Thieves).
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,name=draenic_agility,if=buff.bloodlust.react|target.time_to_die<40|buff.shadow_dance.up&(trinket.proc.agi.react|trinket.proc.multistrike.react|trinket.stacking_proc.agi.react|trinket.stacking_proc.multistrike.react|buff.archmages_greater_incandescence_agi.react)
9 8.41 kick
A 2.88 use_item,slot=trinket2,if=buff.shadow_dance.up
B 2.88 shadow_reflection,if=buff.shadow_dance.up
C 0.00 blood_fury,if=buff.shadow_dance.up
D 0.00 berserking,if=buff.shadow_dance.up
E 0.00 arcane_torrent,if=energy<60&buff.shadow_dance.up
F 0.00 slice_and_dice,if=buff.slice_and_dice.remains<10.8&buff.slice_and_dice.remains<target.time_to_die&combo_points=((target.time_to_die-buff.slice_and_dice.remains)%6)+1
G 8.77 premeditation,if=combo_points<=4&!(buff.shadow_dance.up&energy>100&combo_points>1)&!buff.subterfuge.up|(buff.subterfuge.up&debuff.find_weakness.up)
H 0.00 pool_resource,for_next=1
I 1.00 garrote,if=!ticking&time<1
J 2.51 wait,sec=1,if=buff.subterfuge.remains>1.1&buff.subterfuge.remains<1.3&time>6
K 0.00 pool_resource,for_next=1
L 30.97 ambush,if=combo_points<5|(talent.anticipation.enabled&anticipation_charges<3)&(time<1.2|buff.shadow_dance.up|time>5)
M 0.00 pool_resource,for_next=1,extra_amount=50
N 5.31 shadow_dance,if=energy>=50&buff.stealth.down&buff.vanish.down&debuff.find_weakness.down|(buff.bloodlust.up&(dot.hemorrhage.ticking|dot.garrote.ticking|dot.rupture.ticking))
O 0.00 pool_resource,for_next=1,extra_amount=50
P 0.00 vanish,if=talent.shadow_focus.enabled&energy>=45&energy<=75&combo_points<=3&buff.shadow_dance.down&buff.master_of_subtlety.down&debuff.find_weakness.down
Q 0.00 pool_resource,for_next=1,extra_amount=90
R 4.17 vanish,if=talent.subterfuge.enabled&energy>=90&combo_points<=3&buff.shadow_dance.down&buff.master_of_subtlety.down&debuff.find_weakness.down
S 0.00 marked_for_death,if=combo_points=0
T 0.00 run_action_list,name=generator,if=talent.anticipation.enabled&anticipation_charges<4&buff.slice_and_dice.up&dot.rupture.remains>2&(buff.slice_and_dice.remains<6|dot.rupture.remains<4)
U 0.00 run_action_list,name=finisher,if=combo_points=5
V 0.00 run_action_list,name=generator,if=combo_points<4|(combo_points=4&cooldown.honor_among_thieves.remains>1&energy>70-energy.regen)|talent.anticipation.enabled
W 0.00 run_action_list,name=pool
actions.generator Combo point generators
# count action,conditions
X 0.00 run_action_list,name=pool,if=buff.master_of_subtlety.down&buff.shadow_dance.down&debuff.find_weakness.down&(energy+cooldown.shadow_dance.remains*energy.regen<80|energy+cooldown.vanish.remains*energy.regen<60)
Y 0.00 fan_of_knives,if=active_enemies>1
Z 0.00 shuriken_toss,if=energy<65&energy.regen<16
a 82.60 backstab
b 0.00 hemorrhage,if=position_front
c 0.00 run_action_list,name=pool
actions.finisher Combo point finishers
# count action,conditions
d 17.09 rupture,cycle_targets=1,if=(!ticking|remains<duration*0.3)&active_enemies<=3&(cooldown.death_from_above.remains>0|!talent.death_from_above.enabled)
e 7.83 slice_and_dice,if=buff.slice_and_dice.remains<10.8&buff.slice_and_dice.remains<target.time_to_die
f 0.00 death_from_above
g 0.00 crimson_tempest,if=(active_enemies>=3&dot.crimson_tempest_dot.ticks_remain<=2&combo_points=5)|active_enemies>=5&(cooldown.death_from_above.remains>0|!talent.death_from_above.enabled)
h 33.55 eviscerate,if=active_enemies<4|(active_enemies>3&dot.crimson_tempest_dot.ticks_remain>=2)&(cooldown.death_from_above.remains>0|!talent.death_from_above.enabled)
i 0.00 run_action_list,name=pool
actions.pool Resource pooling
# count action,conditions
j 1.15 preparation,if=!buff.vanish.up&cooldown.vanish.remains>60

Sample Sequence

0124567GILNABLd9LLhLhLhaadaaahRGLLdajaaeaa9hhRLGJLdahaahaNLLdLLeaaa9hhaahaaadaahaaeaaadaaha9ahNABGL8LdLLhhaaeaahRGLJLdaha9ahaadaaaeaaadahNGLLhLL9hhaaadaahaaaaeaaadhaah9aaadRGLhaeaaaNABLhLdLLhaha9ahaadaaaeaaahadaa

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 120.0/120: 100% energy | 5.0/5: 100% combo_points
Pre food Fluffy_Pillow 120.0/120: 100% energy | 5.0/5: 100% combo_points
Pre apply_poison Fluffy_Pillow 120.0/120: 100% energy | 5.0/5: 100% combo_points
Pre potion Fluffy_Pillow 120.0/120: 100% energy | 5.0/5: 100% combo_points draenic_agility_potion
Pre stealth Fluffy_Pillow 120.0/120: 100% energy | 5.0/5: 100% combo_points draenic_agility_potion
Pre slice_and_dice Fluffy_Pillow 120.0/120: 100% energy | 0.0/5: 0% combo_points slice_and_dice, draenic_agility_potion
Pre honor_among_thieves Fluffy_Pillow 120.0/120: 100% energy | 0.0/5: 0% combo_points slice_and_dice, draenic_agility_potion
0:00.000 premeditation Fluffy_Pillow 120.0/120: 100% energy | 0.0/5: 0% combo_points slice_and_dice, draenic_agility_potion
0:00.000 garrote Fluffy_Pillow 120.0/120: 100% energy | 2.0/5: 40% combo_points slice_and_dice, draenic_agility_potion
0:01.005 ambush Fluffy_Pillow 89.2/120: 74% energy | 3.0/5: 60% combo_points bloodlust, subterfuge, slice_and_dice, spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion
0:02.010 shadow_dance Fluffy_Pillow 51.4/120: 43% energy | 5.0/5: 100% combo_points bloodlust, subterfuge, slice_and_dice, spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion
0:02.010 use_item_lucky_doublesided_coin Fluffy_Pillow 51.4/120: 43% energy | 5.0/5: 100% combo_points bloodlust, shadow_dance, subterfuge, slice_and_dice, spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion
0:02.010 shadow_reflection Fluffy_Pillow 51.4/120: 43% energy | 5.0/5: 100% combo_points bloodlust, shadow_dance, subterfuge, slice_and_dice, spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
0:02.010 ambush Fluffy_Pillow 51.4/120: 43% energy | 5.0/5: 100% combo_points bloodlust, shadow_dance, subterfuge, slice_and_dice, shadow_reflection, spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
0:03.014 rupture Fluffy_Pillow 25.5/120: 21% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety, shadow_dance, slice_and_dice, shadow_reflection, anticipation(3), spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
0:04.018 kick Fluffy_Pillow 47.7/120: 40% energy | 3.0/5: 60% combo_points bloodlust, master_of_subtlety, shadow_dance, slice_and_dice, shadow_reflection, spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
0:04.018 ambush Fluffy_Pillow 47.7/120: 40% energy | 3.0/5: 60% combo_points bloodlust, master_of_subtlety, shadow_dance, slice_and_dice, shadow_reflection, spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
0:06.049 ambush Fluffy_Pillow 44.3/120: 37% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety, shadow_dance, slice_and_dice, shadow_reflection, anticipation, spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
0:07.053 Waiting 0.961 sec 18.5/120: 15% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety, shadow_dance, slice_and_dice, shadow_reflection, anticipation(4), spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
0:08.014 eviscerate Fluffy_Pillow 40.0/120: 33% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety, shadow_dance, slice_and_dice, shadow_reflection, anticipation(4), spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
0:09.018 ambush Fluffy_Pillow 44.2/120: 37% energy | 5.0/5: 100% combo_points bloodlust, shadow_dance, slice_and_dice, shadow_reflection, spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
0:10.790 eviscerate Fluffy_Pillow 37.2/120: 31% energy | 5.0/5: 100% combo_points bloodlust, shadow_dance, slice_and_dice, shadow_reflection, anticipation(3), spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
0:11.795 ambush Fluffy_Pillow 41.4/120: 34% energy | 3.0/5: 60% combo_points bloodlust, shadow_dance, slice_and_dice, shadow_reflection, spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
0:12.801 Waiting 0.901 sec 23.6/120: 20% energy | 5.0/5: 100% combo_points bloodlust, slice_and_dice, shadow_reflection, spirit_of_the_warlords, draenic_agility_potion, lucky_flip
0:13.702 eviscerate Fluffy_Pillow 36.3/120: 30% energy | 5.0/5: 100% combo_points bloodlust, slice_and_dice, shadow_reflection, anticipation, spirit_of_the_warlords, draenic_agility_potion, lucky_flip
0:14.707 backstab Fluffy_Pillow 48.5/120: 40% energy | 1.0/5: 20% combo_points bloodlust, slice_and_dice, shadow_reflection, spirit_of_the_warlords, draenic_agility_potion, lucky_flip
0:15.711 Waiting 0.300 sec 27.6/120: 23% energy | 3.0/5: 60% combo_points bloodlust, slice_and_dice, shadow_reflection, spirit_of_the_warlords, draenic_agility_potion, lucky_flip
0:16.011 backstab Fluffy_Pillow 39.8/120: 33% energy | 3.0/5: 60% combo_points bloodlust, slice_and_dice, shadow_reflection, spirit_of_the_warlords, draenic_agility_potion, lucky_flip
0:17.016 Waiting 0.523 sec 19.0/120: 16% energy | 4.0/5: 80% combo_points bloodlust, slice_and_dice, shadow_reflection, spirit_of_the_warlords, draenic_agility_potion, lucky_flip
0:17.539 rupture Fluffy_Pillow 26.4/120: 22% energy | 5.0/5: 100% combo_points bloodlust, slice_and_dice, shadow_reflection, spirit_of_the_warlords, draenic_agility_potion, lucky_flip
0:18.544 backstab Fluffy_Pillow 48.6/120: 40% energy | 0.0/5: 0% combo_points bloodlust, slice_and_dice, spirit_of_the_warlords, draenic_agility_potion, lucky_flip
0:19.549 Waiting 0.500 sec 27.8/120: 23% energy | 2.0/5: 40% combo_points bloodlust, slice_and_dice, spirit_of_the_warlords, draenic_agility_potion, lucky_flip
0:20.049 backstab Fluffy_Pillow 42.8/120: 36% energy | 2.0/5: 40% combo_points bloodlust, slice_and_dice, lucky_flip
0:21.054 Waiting 2.213 sec 22.0/120: 18% energy | 3.0/5: 60% combo_points bloodlust, slice_and_dice, lucky_flip
0:23.267 backstab Fluffy_Pillow 61.2/120: 51% energy | 4.0/5: 80% combo_points bloodlust, slice_and_dice
0:24.271 eviscerate Fluffy_Pillow 48.4/120: 40% energy | 5.0/5: 100% combo_points bloodlust, slice_and_dice, anticipation
0:27.577 vanish Fluffy_Pillow 93.0/120: 77% energy | 2.0/5: 40% combo_points bloodlust, slice_and_dice
0:27.577 premeditation Fluffy_Pillow 93.0/120: 77% energy | 2.0/5: 40% combo_points bloodlust, master_of_subtlety_passive, stealth, vanish, slice_and_dice
0:27.577 ambush Fluffy_Pillow 93.0/120: 77% energy | 4.0/5: 80% combo_points bloodlust, master_of_subtlety_passive, stealth, vanish, slice_and_dice
0:29.093 ambush Fluffy_Pillow 62.4/120: 52% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety_passive, stealth, vanish, subterfuge, slice_and_dice, anticipation(2)
0:30.097 Waiting 0.100 sec 24.5/120: 20% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety_passive, stealth, vanish, subterfuge, slice_and_dice, anticipation(4)
0:30.197 rupture Fluffy_Pillow 26.0/120: 22% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety_passive, stealth, vanish, subterfuge, slice_and_dice, anticipation(4)
0:31.201 backstab Fluffy_Pillow 40.1/120: 33% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety, slice_and_dice
0:32.206 preparation Fluffy_Pillow 27.3/120: 23% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety, slice_and_dice, anticipation
0:33.210 backstab Fluffy_Pillow 41.5/120: 35% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety, slice_and_dice, anticipation(2)
0:34.213 Waiting 0.500 sec 28.6/120: 24% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety, slice_and_dice, anticipation(3)
0:34.713 backstab Fluffy_Pillow 35.7/120: 30% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety, slice_and_dice, anticipation(3)
0:35.718 Waiting 0.720 sec 14.8/120: 12% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety, slice_and_dice, anticipation(5)
0:36.438 slice_and_dice Fluffy_Pillow 33.0/120: 27% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety, anticipation(5)
0:37.441 backstab Fluffy_Pillow 47.1/120: 39% energy | 0.0/5: 0% combo_points bloodlust, slice_and_dice, anticipation(5)
0:38.446 Waiting 0.100 sec 34.3/120: 29% energy | 2.0/5: 40% combo_points bloodlust, slice_and_dice, anticipation(5)
0:38.546 backstab Fluffy_Pillow 35.7/120: 30% energy | 2.0/5: 40% combo_points bloodlust, slice_and_dice, anticipation(5)
0:39.807 Waiting 0.759 sec 18.5/120: 15% energy | 4.0/5: 80% combo_points bloodlust, slice_and_dice, anticipation(5)
0:40.566 kick Fluffy_Pillow 37.2/120: 31% energy | 4.0/5: 80% combo_points bloodlust, slice_and_dice, anticipation(5)
0:40.566 Waiting 1.300 sec 37.2/120: 31% energy | 4.0/5: 80% combo_points bloodlust, slice_and_dice, anticipation(5)
0:41.866 eviscerate Fluffy_Pillow 52.6/120: 44% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(5)
0:42.872 eviscerate Fluffy_Pillow 61.5/120: 51% energy | 5.0/5: 100% combo_points slice_and_dice
0:45.921 vanish Fluffy_Pillow 92.6/120: 77% energy | 1.0/5: 20% combo_points slice_and_dice
0:45.921 ambush Fluffy_Pillow 92.6/120: 77% energy | 1.0/5: 20% combo_points master_of_subtlety_passive, stealth, vanish, slice_and_dice
0:47.696 premeditation Fluffy_Pillow 59.9/120: 50% energy | 4.0/5: 80% combo_points master_of_subtlety_passive, stealth, vanish, subterfuge, slice_and_dice
0:47.696 wait Fluffy_Pillow 59.9/120: 50% energy | 5.0/5: 100% combo_points master_of_subtlety_passive, stealth, vanish, subterfuge, slice_and_dice
0:48.696 ambush Fluffy_Pillow 78.7/120: 66% energy | 5.0/5: 100% combo_points master_of_subtlety_passive, stealth, vanish, subterfuge, slice_and_dice, anticipation
0:49.699 rupture Fluffy_Pillow 29.6/120: 25% energy | 5.0/5: 100% combo_points master_of_subtlety, slice_and_dice, anticipation(3)
0:50.702 backstab Fluffy_Pillow 48.5/120: 40% energy | 4.0/5: 80% combo_points master_of_subtlety, slice_and_dice
0:51.707 Waiting 0.800 sec 24.4/120: 20% energy | 5.0/5: 100% combo_points master_of_subtlety, slice_and_dice
0:52.507 eviscerate Fluffy_Pillow 41.1/120: 34% energy | 5.0/5: 100% combo_points master_of_subtlety, slice_and_dice
0:53.511 backstab Fluffy_Pillow 42.0/120: 35% energy | 1.0/5: 20% combo_points master_of_subtlety, slice_and_dice
0:54.516 Waiting 0.900 sec 25.9/120: 22% energy | 2.0/5: 40% combo_points master_of_subtlety, slice_and_dice
0:55.416 backstab Fluffy_Pillow 35.7/120: 30% energy | 3.0/5: 60% combo_points slice_and_dice, mark_of_bleeding_hollow
0:56.420 Waiting 1.439 sec 11.5/120: 10% energy | 4.0/5: 80% combo_points slice_and_dice, mark_of_bleeding_hollow
0:57.859 eviscerate Fluffy_Pillow 35.2/120: 29% energy | 5.0/5: 100% combo_points slice_and_dice, mark_of_bleeding_hollow
0:58.862 Waiting 1.600 sec 44.0/120: 37% energy | 0.0/5: 0% combo_points slice_and_dice, mark_of_bleeding_hollow
1:00.462 backstab Fluffy_Pillow 69.4/120: 58% energy | 1.0/5: 20% combo_points slice_and_dice, mark_of_bleeding_hollow
1:01.467 Waiting 0.600 sec 45.3/120: 38% energy | 2.0/5: 40% combo_points slice_and_dice, mark_of_bleeding_hollow
1:02.067 shadow_dance Fluffy_Pillow 51.8/120: 43% energy | 3.0/5: 60% combo_points slice_and_dice, mark_of_bleeding_hollow
1:02.067 ambush Fluffy_Pillow 51.8/120: 43% energy | 3.0/5: 60% combo_points shadow_dance, slice_and_dice, mark_of_bleeding_hollow
1:04.094 ambush Fluffy_Pillow 41.8/120: 35% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation, mark_of_bleeding_hollow
1:05.098 Waiting 0.495 sec 20.7/120: 17% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(3), mark_of_bleeding_hollow
1:05.593 rupture Fluffy_Pillow 26.1/120: 22% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(3), mark_of_bleeding_hollow
1:06.596 ambush Fluffy_Pillow 45.0/120: 37% energy | 4.0/5: 80% combo_points shadow_dance, slice_and_dice, mark_of_bleeding_hollow
1:09.134 ambush Fluffy_Pillow 40.5/120: 34% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(2)
1:10.138 Waiting 1.253 sec 11.4/120: 9% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(4)
1:11.391 slice_and_dice Fluffy_Pillow 33.0/120: 27% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(5)
1:12.396 backstab Fluffy_Pillow 43.9/120: 37% energy | 0.0/5: 0% combo_points slice_and_dice, anticipation(5)
1:13.400 Waiting 0.700 sec 27.8/120: 23% energy | 2.0/5: 40% combo_points slice_and_dice, anticipation(5)
1:14.100 backstab Fluffy_Pillow 35.4/120: 29% energy | 2.0/5: 40% combo_points slice_and_dice, anticipation(5)
1:15.103 Waiting 1.427 sec 19.3/120: 16% energy | 4.0/5: 80% combo_points slice_and_dice, anticipation(5)
1:16.530 backstab Fluffy_Pillow 42.8/120: 36% energy | 4.0/5: 80% combo_points slice_and_dice, anticipation(5)
1:17.536 Waiting 0.583 sec 18.7/120: 16% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(5)
1:18.119 kick Fluffy_Pillow 25.0/120: 21% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(5)
1:18.119 Waiting 0.400 sec 25.0/120: 21% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(5)
1:18.519 eviscerate Fluffy_Pillow 37.3/120: 31% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(5)
1:19.524 eviscerate Fluffy_Pillow 38.2/120: 32% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
1:20.529 backstab Fluffy_Pillow 47.1/120: 39% energy | 1.0/5: 20% combo_points slice_and_dice
1:21.533 Waiting 0.980 sec 23.0/120: 19% energy | 3.0/5: 60% combo_points slice_and_dice
1:22.513 backstab Fluffy_Pillow 41.7/120: 35% energy | 3.0/5: 60% combo_points slice_and_dice
1:23.517 Waiting 0.984 sec 17.6/120: 15% energy | 5.0/5: 100% combo_points slice_and_dice
1:24.501 eviscerate Fluffy_Pillow 36.2/120: 30% energy | 5.0/5: 100% combo_points slice_and_dice
1:25.505 backstab Fluffy_Pillow 37.1/120: 31% energy | 0.0/5: 0% combo_points slice_and_dice
1:26.509 Waiting 1.365 sec 21.0/120: 18% energy | 2.0/5: 40% combo_points slice_and_dice, mark_of_bleeding_hollow
1:27.874 backstab Fluffy_Pillow 35.8/120: 30% energy | 3.0/5: 60% combo_points slice_and_dice, mark_of_bleeding_hollow
1:28.879 Waiting 1.483 sec 19.8/120: 16% energy | 4.0/5: 80% combo_points slice_and_dice, mark_of_bleeding_hollow
1:30.362 backstab Fluffy_Pillow 35.8/120: 30% energy | 5.0/5: 100% combo_points slice_and_dice, mark_of_bleeding_hollow
1:31.366 Waiting 0.584 sec 19.7/120: 16% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation, mark_of_bleeding_hollow
1:31.950 rupture Fluffy_Pillow 26.1/120: 22% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation, mark_of_bleeding_hollow
1:32.954 backstab Fluffy_Pillow 45.0/120: 37% energy | 2.0/5: 40% combo_points slice_and_dice, mark_of_bleeding_hollow
1:33.959 Waiting 0.580 sec 20.9/120: 17% energy | 3.0/5: 60% combo_points slice_and_dice, mark_of_bleeding_hollow
1:34.539 backstab Fluffy_Pillow 35.2/120: 29% energy | 4.0/5: 80% combo_points slice_and_dice, mark_of_bleeding_hollow
1:35.544 Waiting 1.483 sec 11.1/120: 9% energy | 5.0/5: 100% combo_points slice_and_dice, mark_of_bleeding_hollow
1:37.027 eviscerate Fluffy_Pillow 35.2/120: 29% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation, mark_of_bleeding_hollow
1:38.032 backstab Fluffy_Pillow 36.1/120: 30% energy | 1.0/5: 20% combo_points slice_and_dice, mark_of_bleeding_hollow
1:39.035 Waiting 1.465 sec 20.0/120: 17% energy | 3.0/5: 60% combo_points slice_and_dice
1:40.500 backstab Fluffy_Pillow 43.8/120: 37% energy | 3.0/5: 60% combo_points slice_and_dice
1:41.505 Waiting 0.583 sec 19.8/120: 16% energy | 5.0/5: 100% combo_points slice_and_dice
1:42.088 slice_and_dice Fluffy_Pillow 26.1/120: 22% energy | 5.0/5: 100% combo_points slice_and_dice
1:43.093 backstab Fluffy_Pillow 45.0/120: 37% energy | 0.0/5: 0% combo_points slice_and_dice
1:44.097 Waiting 0.579 sec 20.9/120: 17% energy | 2.0/5: 40% combo_points slice_and_dice
1:44.676 backstab Fluffy_Pillow 35.2/120: 29% energy | 2.0/5: 40% combo_points slice_and_dice
1:45.682 Waiting 1.483 sec 11.1/120: 9% energy | 4.0/5: 80% combo_points slice_and_dice
1:47.165 backstab Fluffy_Pillow 35.2/120: 29% energy | 4.0/5: 80% combo_points slice_and_dice
1:48.167 Waiting 1.286 sec 11.0/120: 9% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
1:49.453 rupture Fluffy_Pillow 33.0/120: 27% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
1:50.458 backstab Fluffy_Pillow 51.9/120: 43% energy | 2.0/5: 40% combo_points slice_and_dice
1:51.465 Waiting 0.700 sec 27.8/120: 23% energy | 3.0/5: 60% combo_points slice_and_dice
1:52.165 backstab Fluffy_Pillow 35.4/120: 30% energy | 3.0/5: 60% combo_points slice_and_dice
1:53.170 Waiting 1.322 sec 19.3/120: 16% energy | 5.0/5: 100% combo_points slice_and_dice
1:54.492 eviscerate Fluffy_Pillow 41.7/120: 35% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
1:55.496 backstab Fluffy_Pillow 42.6/120: 35% energy | 1.0/5: 20% combo_points slice_and_dice
1:56.499 kick Fluffy_Pillow 26.4/120: 22% energy | 2.0/5: 40% combo_points slice_and_dice
1:56.499 Waiting 0.800 sec 26.4/120: 22% energy | 2.0/5: 40% combo_points slice_and_dice
1:57.299 backstab Fluffy_Pillow 35.1/120: 29% energy | 3.0/5: 60% combo_points slice_and_dice
1:58.304 Waiting 1.487 sec 11.0/120: 9% energy | 4.0/5: 80% combo_points slice_and_dice, mark_of_bleeding_hollow
1:59.791 eviscerate Fluffy_Pillow 35.2/120: 29% energy | 5.0/5: 100% combo_points slice_and_dice, mark_of_bleeding_hollow
2:00.796 Waiting 1.300 sec 44.1/120: 37% energy | 0.0/5: 0% combo_points slice_and_dice, mark_of_bleeding_hollow
2:02.096 shadow_dance Fluffy_Pillow 58.2/120: 48% energy | 1.0/5: 20% combo_points slice_and_dice, mark_of_bleeding_hollow
2:02.096 use_item_lucky_doublesided_coin Fluffy_Pillow 58.2/120: 48% energy | 1.0/5: 20% combo_points shadow_dance, slice_and_dice, mark_of_bleeding_hollow
2:02.096 shadow_reflection Fluffy_Pillow 58.2/120: 48% energy | 1.0/5: 20% combo_points shadow_dance, slice_and_dice, mark_of_bleeding_hollow, lucky_flip
2:02.096 premeditation Fluffy_Pillow 58.2/120: 48% energy | 1.0/5: 20% combo_points shadow_dance, slice_and_dice, shadow_reflection, mark_of_bleeding_hollow, lucky_flip
2:02.096 ambush Fluffy_Pillow 58.2/120: 48% energy | 3.0/5: 60% combo_points shadow_dance, slice_and_dice, shadow_reflection, mark_of_bleeding_hollow, lucky_flip
2:03.099 potion Fluffy_Pillow 37.1/120: 31% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, mark_of_bleeding_hollow, lucky_flip
2:03.609 ambush Fluffy_Pillow 42.6/120: 35% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation, spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
2:04.615 Waiting 0.421 sec 21.5/120: 18% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation(3), spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
2:05.036 rupture Fluffy_Pillow 26.1/120: 22% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation(3), spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
2:06.550 ambush Fluffy_Pillow 50.5/120: 42% energy | 4.0/5: 80% combo_points shadow_dance, slice_and_dice, shadow_reflection, spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
2:08.573 ambush Fluffy_Pillow 40.5/120: 34% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation(2), spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
2:09.576 Waiting 1.458 sec 11.3/120: 9% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation(4), spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
2:11.034 eviscerate Fluffy_Pillow 35.2/120: 29% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation(5), spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
2:12.293 eviscerate Fluffy_Pillow 38.8/120: 32% energy | 5.0/5: 100% combo_points slice_and_dice, shadow_reflection, spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
2:13.299 backstab Fluffy_Pillow 47.7/120: 40% energy | 1.0/5: 20% combo_points slice_and_dice, shadow_reflection, spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
2:14.302 Waiting 0.326 sec 23.6/120: 20% energy | 2.0/5: 40% combo_points slice_and_dice, shadow_reflection, spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
2:14.628 backstab Fluffy_Pillow 35.2/120: 29% energy | 3.0/5: 60% combo_points slice_and_dice, shadow_reflection, spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
2:15.632 Waiting 1.285 sec 11.1/120: 9% energy | 4.0/5: 80% combo_points slice_and_dice, shadow_reflection, spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
2:16.917 slice_and_dice Fluffy_Pillow 33.0/120: 27% energy | 5.0/5: 100% combo_points slice_and_dice, shadow_reflection, spirit_of_the_warlords, draenic_agility_potion, lucky_flip
2:17.922 backstab Fluffy_Pillow 43.9/120: 37% energy | 0.0/5: 0% combo_points slice_and_dice, shadow_reflection, spirit_of_the_warlords, draenic_agility_potion, lucky_flip
2:23.274 backstab Fluffy_Pillow 91.0/120: 76% energy | 4.0/5: 80% combo_points slice_and_dice, spirit_of_the_warlords, draenic_agility_potion
2:24.278 eviscerate Fluffy_Pillow 66.9/120: 56% energy | 5.0/5: 100% combo_points slice_and_dice, draenic_agility_potion
2:26.561 vanish Fluffy_Pillow 97.6/120: 81% energy | 1.0/5: 20% combo_points slice_and_dice, draenic_agility_potion
2:26.561 premeditation Fluffy_Pillow 97.6/120: 81% energy | 1.0/5: 20% combo_points master_of_subtlety_passive, stealth, vanish, slice_and_dice, draenic_agility_potion
2:26.561 ambush Fluffy_Pillow 97.6/120: 81% energy | 3.0/5: 60% combo_points master_of_subtlety_passive, stealth, vanish, slice_and_dice, draenic_agility_potion
2:28.334 wait Fluffy_Pillow 56.9/120: 47% energy | 5.0/5: 100% combo_points master_of_subtlety_passive, stealth, vanish, subterfuge, slice_and_dice, anticipation
2:29.334 ambush Fluffy_Pillow 75.7/120: 63% energy | 5.0/5: 100% combo_points master_of_subtlety_passive, stealth, vanish, subterfuge, slice_and_dice, anticipation
2:30.337 rupture Fluffy_Pillow 26.6/120: 22% energy | 5.0/5: 100% combo_points master_of_subtlety, slice_and_dice, anticipation(4)
2:31.340 backstab Fluffy_Pillow 45.5/120: 38% energy | 4.0/5: 80% combo_points master_of_subtlety, slice_and_dice
2:32.344 Waiting 0.532 sec 21.4/120: 18% energy | 5.0/5: 100% combo_points master_of_subtlety, slice_and_dice, anticipation
2:32.876 eviscerate Fluffy_Pillow 35.2/120: 29% energy | 5.0/5: 100% combo_points master_of_subtlety, slice_and_dice, anticipation
2:33.882 backstab Fluffy_Pillow 36.1/120: 30% energy | 1.0/5: 20% combo_points master_of_subtlety, slice_and_dice
2:34.886 kick Fluffy_Pillow 20.0/120: 17% energy | 3.0/5: 60% combo_points master_of_subtlety, slice_and_dice
2:34.886 Waiting 1.463 sec 20.0/120: 17% energy | 3.0/5: 60% combo_points master_of_subtlety, slice_and_dice
2:36.349 backstab Fluffy_Pillow 35.8/120: 30% energy | 3.0/5: 60% combo_points slice_and_dice
2:37.353 Waiting 1.084 sec 19.7/120: 16% energy | 5.0/5: 100% combo_points slice_and_dice
2:38.437 eviscerate Fluffy_Pillow 39.5/120: 33% energy | 5.0/5: 100% combo_points slice_and_dice, mark_of_bleeding_hollow
2:39.442 backstab Fluffy_Pillow 40.4/120: 34% energy | 1.0/5: 20% combo_points slice_and_dice, mark_of_bleeding_hollow
2:40.445 Waiting 1.000 sec 24.3/120: 20% energy | 2.0/5: 40% combo_points slice_and_dice, mark_of_bleeding_hollow
2:41.445 backstab Fluffy_Pillow 35.1/120: 29% energy | 3.0/5: 60% combo_points slice_and_dice, mark_of_bleeding_hollow
2:42.449 Waiting 0.849 sec 19.0/120: 16% energy | 4.0/5: 80% combo_points slice_and_dice, mark_of_bleeding_hollow
2:43.298 rupture Fluffy_Pillow 28.3/120: 24% energy | 5.0/5: 100% combo_points slice_and_dice, mark_of_bleeding_hollow
2:44.303 backstab Fluffy_Pillow 39.2/120: 33% energy | 0.0/5: 0% combo_points slice_and_dice, mark_of_bleeding_hollow
2:45.307 Waiting 1.179 sec 23.0/120: 19% energy | 1.0/5: 20% combo_points slice_and_dice, mark_of_bleeding_hollow
2:46.486 backstab Fluffy_Pillow 43.8/120: 37% energy | 2.0/5: 40% combo_points slice_and_dice, mark_of_bleeding_hollow
2:47.490 Waiting 0.985 sec 19.7/120: 16% energy | 3.0/5: 60% combo_points slice_and_dice, mark_of_bleeding_hollow
2:48.475 backstab Fluffy_Pillow 38.4/120: 32% energy | 4.0/5: 80% combo_points slice_and_dice, mark_of_bleeding_hollow
2:49.479 Waiting 0.984 sec 14.3/120: 12% energy | 5.0/5: 100% combo_points slice_and_dice, mark_of_bleeding_hollow
2:50.463 slice_and_dice Fluffy_Pillow 33.0/120: 27% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
2:51.468 backstab Fluffy_Pillow 43.9/120: 37% energy | 0.0/5: 0% combo_points slice_and_dice, anticipation
2:52.471 Waiting 0.700 sec 27.8/120: 23% energy | 2.0/5: 40% combo_points slice_and_dice, anticipation
2:53.171 backstab Fluffy_Pillow 35.4/120: 29% energy | 2.0/5: 40% combo_points slice_and_dice, anticipation
2:54.176 Waiting 1.464 sec 11.3/120: 9% energy | 3.0/5: 60% combo_points slice_and_dice, anticipation
2:55.640 backstab Fluffy_Pillow 35.2/120: 29% energy | 4.0/5: 80% combo_points slice_and_dice, anticipation
2:56.647 Waiting 0.644 sec 19.1/120: 16% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
2:57.291 rupture Fluffy_Pillow 26.1/120: 22% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(2)
2:58.297 Waiting 0.200 sec 37.0/120: 31% energy | 2.0/5: 40% combo_points slice_and_dice
2:58.497 backstab Fluffy_Pillow 47.2/120: 39% energy | 2.0/5: 40% combo_points slice_and_dice
2:59.501 Waiting 1.878 sec 23.1/120: 19% energy | 4.0/5: 80% combo_points slice_and_dice
3:01.379 eviscerate Fluffy_Pillow 51.4/120: 43% energy | 5.0/5: 100% combo_points slice_and_dice
3:02.382 shadow_dance Fluffy_Pillow 52.3/120: 44% energy | 0.0/5: 0% combo_points slice_and_dice
3:02.382 premeditation Fluffy_Pillow 52.3/120: 44% energy | 0.0/5: 0% combo_points shadow_dance, slice_and_dice
3:02.382 ambush Fluffy_Pillow 52.3/120: 44% energy | 2.0/5: 40% combo_points shadow_dance, slice_and_dice
3:04.407 ambush Fluffy_Pillow 42.3/120: 35% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice
3:05.923 Waiting 0.600 sec 26.7/120: 22% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(3)
3:06.523 eviscerate Fluffy_Pillow 41.3/120: 34% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(3)
3:07.526 ambush Fluffy_Pillow 42.1/120: 35% energy | 3.0/5: 60% combo_points shadow_dance, slice_and_dice
3:10.316 ambush Fluffy_Pillow 40.4/120: 34% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(2)
3:11.319 Waiting 0.525 sec 19.3/120: 16% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(4)
3:11.844 kick Fluffy_Pillow 25.0/120: 21% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(4)
3:11.844 Waiting 0.600 sec 25.0/120: 21% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(4)
3:12.444 eviscerate Fluffy_Pillow 39.5/120: 33% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(5)
3:13.447 eviscerate Fluffy_Pillow 40.4/120: 34% energy | 5.0/5: 100% combo_points slice_and_dice
3:14.451 backstab Fluffy_Pillow 49.3/120: 41% energy | 0.0/5: 0% combo_points slice_and_dice
3:15.455 Waiting 1.000 sec 25.2/120: 21% energy | 2.0/5: 40% combo_points slice_and_dice
3:16.455 backstab Fluffy_Pillow 44.0/120: 37% energy | 2.0/5: 40% combo_points slice_and_dice
3:17.460 Waiting 1.067 sec 19.9/120: 17% energy | 4.0/5: 80% combo_points slice_and_dice
3:18.527 backstab Fluffy_Pillow 39.5/120: 33% energy | 4.0/5: 80% combo_points slice_and_dice
3:19.530 Waiting 0.985 sec 15.4/120: 13% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
3:20.515 rupture Fluffy_Pillow 34.1/120: 28% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
3:21.520 backstab Fluffy_Pillow 45.0/120: 37% energy | 2.0/5: 40% combo_points slice_and_dice
3:22.524 Waiting 0.600 sec 28.9/120: 24% energy | 3.0/5: 60% combo_points slice_and_dice
3:23.124 backstab Fluffy_Pillow 35.4/120: 29% energy | 3.0/5: 60% combo_points slice_and_dice
3:24.127 Waiting 1.465 sec 11.3/120: 9% energy | 5.0/5: 100% combo_points slice_and_dice
3:25.592 eviscerate Fluffy_Pillow 35.2/120: 29% energy | 5.0/5: 100% combo_points slice_and_dice
3:26.598 backstab Fluffy_Pillow 44.1/120: 37% energy | 1.0/5: 20% combo_points slice_and_dice
3:27.603 Waiting 0.861 sec 20.0/120: 17% energy | 2.0/5: 40% combo_points slice_and_dice
3:28.464 backstab Fluffy_Pillow 37.3/120: 31% energy | 3.0/5: 60% combo_points slice_and_dice
3:29.467 Waiting 1.285 sec 13.2/120: 11% energy | 4.0/5: 80% combo_points slice_and_dice
3:30.752 backstab Fluffy_Pillow 35.2/120: 29% energy | 5.0/5: 100% combo_points slice_and_dice
3:31.757 Waiting 1.484 sec 11.1/120: 9% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
3:33.241 backstab Fluffy_Pillow 35.2/120: 29% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(2)
3:34.245 Waiting 1.284 sec 11.1/120: 9% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(3)
3:35.529 slice_and_dice Fluffy_Pillow 33.0/120: 27% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(4)
3:36.533 backstab Fluffy_Pillow 51.9/120: 43% energy | 0.0/5: 0% combo_points slice_and_dice, anticipation(4)
3:37.537 Waiting 0.700 sec 27.8/120: 23% energy | 2.0/5: 40% combo_points slice_and_dice, anticipation(4)
3:38.237 backstab Fluffy_Pillow 35.4/120: 29% energy | 2.0/5: 40% combo_points slice_and_dice, anticipation(4)
3:39.241 Waiting 1.227 sec 19.3/120: 16% energy | 3.0/5: 60% combo_points slice_and_dice, anticipation(4)
3:40.468 backstab Fluffy_Pillow 40.6/120: 34% energy | 4.0/5: 80% combo_points slice_and_dice, anticipation(4), mark_of_bleeding_hollow
3:41.472 Waiting 0.885 sec 16.5/120: 14% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(4), mark_of_bleeding_hollow
3:42.357 rupture Fluffy_Pillow 26.1/120: 22% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(5), mark_of_bleeding_hollow
3:43.361 eviscerate Fluffy_Pillow 45.0/120: 37% energy | 5.0/5: 100% combo_points slice_and_dice, mark_of_bleeding_hollow
3:44.365 backstab Fluffy_Pillow 45.9/120: 38% energy | 1.0/5: 20% combo_points slice_and_dice, mark_of_bleeding_hollow
3:45.367 Waiting 0.500 sec 29.7/120: 25% energy | 2.0/5: 40% combo_points slice_and_dice, mark_of_bleeding_hollow
3:45.867 backstab Fluffy_Pillow 35.2/120: 29% energy | 2.0/5: 40% combo_points slice_and_dice, mark_of_bleeding_hollow
3:46.871 Waiting 1.547 sec 19.1/120: 16% energy | 4.0/5: 80% combo_points slice_and_dice, mark_of_bleeding_hollow
3:48.418 eviscerate Fluffy_Pillow 35.8/120: 30% energy | 5.0/5: 100% combo_points slice_and_dice, mark_of_bleeding_hollow
3:49.421 kick Fluffy_Pillow 44.7/120: 37% energy | 0.0/5: 0% combo_points slice_and_dice, mark_of_bleeding_hollow
3:49.421 backstab Fluffy_Pillow 44.7/120: 37% energy | 0.0/5: 0% combo_points slice_and_dice, mark_of_bleeding_hollow
3:50.424 Waiting 0.604 sec 20.6/120: 17% energy | 2.0/5: 40% combo_points slice_and_dice, mark_of_bleeding_hollow
3:51.028 backstab Fluffy_Pillow 35.2/120: 29% energy | 2.0/5: 40% combo_points slice_and_dice, mark_of_bleeding_hollow
3:52.033 Waiting 1.483 sec 11.1/120: 9% energy | 3.0/5: 60% combo_points slice_and_dice, mark_of_bleeding_hollow
3:53.516 backstab Fluffy_Pillow 35.2/120: 29% energy | 4.0/5: 80% combo_points slice_and_dice, mark_of_bleeding_hollow
3:54.520 Waiting 0.647 sec 19.1/120: 16% energy | 5.0/5: 100% combo_points slice_and_dice
3:55.167 rupture Fluffy_Pillow 26.1/120: 22% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
3:56.170 Waiting 0.400 sec 37.0/120: 31% energy | 1.0/5: 20% combo_points slice_and_dice
3:59.633 vanish Fluffy_Pillow 90.5/120: 75% energy | 3.0/5: 60% combo_points slice_and_dice
3:59.633 premeditation Fluffy_Pillow 90.5/120: 75% energy | 3.0/5: 60% combo_points master_of_subtlety_passive, stealth, vanish, slice_and_dice
3:59.633 ambush Fluffy_Pillow 90.5/120: 75% energy | 5.0/5: 100% combo_points master_of_subtlety_passive, stealth, vanish, slice_and_dice
4:01.152 eviscerate Fluffy_Pillow 55.0/120: 46% energy | 5.0/5: 100% combo_points master_of_subtlety_passive, stealth, vanish, subterfuge, slice_and_dice, anticipation(3)
4:02.668 backstab Fluffy_Pillow 69.5/120: 58% energy | 3.0/5: 60% combo_points master_of_subtlety, slice_and_dice, spirit_of_the_warlords
4:03.672 slice_and_dice Fluffy_Pillow 45.4/120: 38% energy | 5.0/5: 100% combo_points master_of_subtlety, slice_and_dice, spirit_of_the_warlords
4:04.675 backstab Fluffy_Pillow 64.2/120: 54% energy | 0.0/5: 0% combo_points master_of_subtlety, slice_and_dice, spirit_of_the_warlords
4:05.679 backstab Fluffy_Pillow 40.1/120: 33% energy | 2.0/5: 40% combo_points master_of_subtlety, slice_and_dice, spirit_of_the_warlords
4:06.682 Waiting 1.100 sec 24.0/120: 20% energy | 3.0/5: 60% combo_points master_of_subtlety, slice_and_dice, spirit_of_the_warlords, mark_of_bleeding_hollow
4:07.782 backstab Fluffy_Pillow 36.0/120: 30% energy | 4.0/5: 80% combo_points master_of_subtlety, slice_and_dice, spirit_of_the_warlords, mark_of_bleeding_hollow
4:08.787 Waiting 0.873 sec 19.9/120: 17% energy | 5.0/5: 100% combo_points slice_and_dice, spirit_of_the_warlords, mark_of_bleeding_hollow
4:10.938 shadow_dance Fluffy_Pillow 51.2/120: 43% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation, spirit_of_the_warlords, mark_of_bleeding_hollow
4:10.938 use_item_lucky_doublesided_coin Fluffy_Pillow 51.2/120: 43% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation, spirit_of_the_warlords, mark_of_bleeding_hollow
4:10.938 shadow_reflection Fluffy_Pillow 51.2/120: 43% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation, spirit_of_the_warlords, mark_of_bleeding_hollow, lucky_flip
4:10.938 ambush Fluffy_Pillow 51.2/120: 43% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation, spirit_of_the_warlords, mark_of_bleeding_hollow, lucky_flip
4:11.942 Waiting 0.567 sec 22.1/120: 18% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation(3), spirit_of_the_warlords, mark_of_bleeding_hollow, lucky_flip
4:12.509 eviscerate Fluffy_Pillow 36.3/120: 30% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation(4), spirit_of_the_warlords, mark_of_bleeding_hollow, lucky_flip
4:14.024 ambush Fluffy_Pillow 42.7/120: 36% energy | 4.0/5: 80% combo_points shadow_dance, slice_and_dice, shadow_reflection, spirit_of_the_warlords, mark_of_bleeding_hollow, lucky_flip
4:16.564 rupture Fluffy_Pillow 46.3/120: 39% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation(3), spirit_of_the_warlords, mark_of_bleeding_hollow, lucky_flip
4:17.569 ambush Fluffy_Pillow 57.2/120: 48% energy | 3.0/5: 60% combo_points shadow_dance, slice_and_dice, shadow_reflection, spirit_of_the_warlords, mark_of_bleeding_hollow, lucky_flip
4:19.083 ambush Fluffy_Pillow 41.6/120: 35% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation, spirit_of_the_warlords, mark_of_bleeding_hollow, lucky_flip
4:20.086 Waiting 1.354 sec 12.5/120: 10% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation(3), spirit_of_the_warlords, mark_of_bleeding_hollow, lucky_flip
4:21.440 eviscerate Fluffy_Pillow 35.2/120: 29% energy | 5.0/5: 100% combo_points slice_and_dice, shadow_reflection, anticipation(4), mark_of_bleeding_hollow, lucky_flip
4:22.444 backstab Fluffy_Pillow 44.1/120: 37% energy | 4.0/5: 80% combo_points slice_and_dice, shadow_reflection, mark_of_bleeding_hollow, lucky_flip
4:23.451 Waiting 1.062 sec 20.0/120: 17% energy | 5.0/5: 100% combo_points slice_and_dice, shadow_reflection, anticipation, mark_of_bleeding_hollow, lucky_flip
4:24.513 eviscerate Fluffy_Pillow 39.5/120: 33% energy | 5.0/5: 100% combo_points slice_and_dice, shadow_reflection, anticipation, mark_of_bleeding_hollow, lucky_flip
4:25.517 backstab Fluffy_Pillow 40.4/120: 34% energy | 2.0/5: 40% combo_points slice_and_dice, shadow_reflection, mark_of_bleeding_hollow, lucky_flip
4:26.522 Waiting 0.100 sec 24.3/120: 20% energy | 3.0/5: 60% combo_points slice_and_dice, shadow_reflection, mark_of_bleeding_hollow, lucky_flip
4:26.622 kick Fluffy_Pillow 25.4/120: 21% energy | 3.0/5: 60% combo_points slice_and_dice, shadow_reflection, mark_of_bleeding_hollow, lucky_flip
4:26.622 Waiting 0.900 sec 25.4/120: 21% energy | 3.0/5: 60% combo_points slice_and_dice, shadow_reflection, mark_of_bleeding_hollow, lucky_flip
4:27.522 backstab Fluffy_Pillow 35.2/120: 29% energy | 4.0/5: 80% combo_points slice_and_dice, mark_of_bleeding_hollow, lucky_flip
4:28.528 Waiting 1.546 sec 19.1/120: 16% energy | 5.0/5: 100% combo_points slice_and_dice, lucky_flip
4:30.074 eviscerate Fluffy_Pillow 35.8/120: 30% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation, lucky_flip
4:31.079 backstab Fluffy_Pillow 44.7/120: 37% energy | 1.0/5: 20% combo_points slice_and_dice
4:32.084 Waiting 0.600 sec 20.7/120: 17% energy | 3.0/5: 60% combo_points slice_and_dice
4:32.684 backstab Fluffy_Pillow 35.2/120: 29% energy | 3.0/5: 60% combo_points slice_and_dice
4:33.689 Waiting 1.283 sec 11.1/120: 9% energy | 4.0/5: 80% combo_points slice_and_dice
4:34.972 rupture Fluffy_Pillow 33.0/120: 27% energy | 5.0/5: 100% combo_points slice_and_dice
4:35.977 backstab Fluffy_Pillow 43.9/120: 37% energy | 0.0/5: 0% combo_points slice_and_dice
4:36.982 Waiting 0.700 sec 27.8/120: 23% energy | 2.0/5: 40% combo_points slice_and_dice
4:37.682 backstab Fluffy_Pillow 35.4/120: 29% energy | 2.0/5: 40% combo_points slice_and_dice
4:38.685 Waiting 1.527 sec 19.3/120: 16% energy | 3.0/5: 60% combo_points slice_and_dice
4:40.212 backstab Fluffy_Pillow 35.8/120: 30% energy | 4.0/5: 80% combo_points slice_and_dice
4:41.218 Waiting 0.582 sec 19.8/120: 16% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
4:41.800 slice_and_dice Fluffy_Pillow 26.1/120: 22% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
4:42.803 backstab Fluffy_Pillow 45.0/120: 37% energy | 0.0/5: 0% combo_points slice_and_dice, anticipation
4:43.806 Waiting 0.682 sec 20.8/120: 17% energy | 2.0/5: 40% combo_points slice_and_dice, anticipation
4:44.488 backstab Fluffy_Pillow 36.2/120: 30% energy | 2.0/5: 40% combo_points slice_and_dice, anticipation
4:45.493 Waiting 1.384 sec 12.2/120: 10% energy | 4.0/5: 80% combo_points slice_and_dice, anticipation
4:46.877 backstab Fluffy_Pillow 35.2/120: 29% energy | 4.0/5: 80% combo_points slice_and_dice, anticipation
4:47.881 Waiting 1.484 sec 11.1/120: 9% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(2)
4:49.365 eviscerate Fluffy_Pillow 35.2/120: 29% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(2)
4:50.369 backstab Fluffy_Pillow 36.1/120: 30% energy | 3.0/5: 60% combo_points slice_and_dice
4:51.373 Waiting 0.665 sec 20.0/120: 17% energy | 4.0/5: 80% combo_points slice_and_dice
4:52.038 rupture Fluffy_Pillow 27.2/120: 23% energy | 5.0/5: 100% combo_points slice_and_dice
4:53.041 backstab Fluffy_Pillow 46.1/120: 38% energy | 0.0/5: 0% combo_points slice_and_dice
4:54.047 Waiting 0.479 sec 22.0/120: 18% energy | 1.0/5: 20% combo_points slice_and_dice
4:54.526 backstab Fluffy_Pillow 35.2/120: 29% energy | 2.0/5: 40% combo_points slice_and_dice
4:55.531 Waiting 1.283 sec 11.1/120: 9% energy | 3.0/5: 60% combo_points slice_and_dice

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 1271 1211 1211
Agility 4895 4359 3675 (1623)
Stamina 4565 4150 4150
Intellect 745 710 710
Spirit 532 532 532
Health 273900 249000 0
Energy 120 120 0
Combo Points 5 5 0
Crit 24.79% 19.79% 527
Haste 8.51% 3.34% 334
Multistrike 22.85% 16.26% 1073
Damage / Heal Versatility 7.46% 4.46% 580
Attack Power 5385 4359 0
Mastery 61.23% 46.23% 815
Armor 957 957 957

Talents

Level
15 Nightstalker Subterfuge Shadow Focus
30 Deadly Throw Nerve Strike Combat Readiness
45 Cheat Death Leeching Poison Elusiveness
60 Cloak and Dagger Shadowstep Burst of Speed
75 Prey on the Weak Internal Bleeding Dirty Tricks
90 Shuriken Toss Marked for Death Anticipation
100 Venom Rush Shadow Reflection Death from Above

Profile

rogue="Mîrai"
origin="http://eu.battle.net/wow/en/character/forscherliga/Mîrai/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/98/74316130-avatar.jpg"
level=100
race=dwarf
role=attack
position=back
professions=jewelcrafting=700/leatherworking=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#cb!1101021
glyphs=hemorrhaging_veins/cloak_of_shadows/energy/poisons/safe_fall
spec=subtlety

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_agility_flask
actions.precombat+=/food,type=calamari_crepes
actions.precombat+=/apply_poison,lethal=deadly
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=draenic_agility
actions.precombat+=/stealth
actions.precombat+=/slice_and_dice
# Proxy Honor Among Thieves action. Generates Combo Points at a mean rate of 2.2 seconds. Comment out to disable (and use the real Honor Among Thieves).
actions.precombat+=/honor_among_thieves,cooldown=2.2,cooldown_stddev=0.1

# Executed every time the actor is available.

actions=potion,name=draenic_agility,if=buff.bloodlust.react|target.time_to_die<40|buff.shadow_dance.up&(trinket.proc.agi.react|trinket.proc.multistrike.react|trinket.stacking_proc.agi.react|trinket.stacking_proc.multistrike.react|buff.archmages_greater_incandescence_agi.react)
actions+=/kick
actions+=/use_item,slot=trinket2,if=buff.shadow_dance.up
actions+=/shadow_reflection,if=buff.shadow_dance.up
actions+=/blood_fury,if=buff.shadow_dance.up
actions+=/berserking,if=buff.shadow_dance.up
actions+=/arcane_torrent,if=energy<60&buff.shadow_dance.up
actions+=/slice_and_dice,if=buff.slice_and_dice.remains<10.8&buff.slice_and_dice.remains<target.time_to_die&combo_points=((target.time_to_die-buff.slice_and_dice.remains)%6)+1
actions+=/premeditation,if=combo_points<=4&!(buff.shadow_dance.up&energy>100&combo_points>1)&!buff.subterfuge.up|(buff.subterfuge.up&debuff.find_weakness.up)
actions+=/pool_resource,for_next=1
actions+=/garrote,if=!ticking&time<1
actions+=/wait,sec=1,if=buff.subterfuge.remains>1.1&buff.subterfuge.remains<1.3&time>6
actions+=/pool_resource,for_next=1
actions+=/ambush,if=combo_points<5|(talent.anticipation.enabled&anticipation_charges<3)&(time<1.2|buff.shadow_dance.up|time>5)
actions+=/pool_resource,for_next=1,extra_amount=50
actions+=/shadow_dance,if=energy>=50&buff.stealth.down&buff.vanish.down&debuff.find_weakness.down|(buff.bloodlust.up&(dot.hemorrhage.ticking|dot.garrote.ticking|dot.rupture.ticking))
actions+=/pool_resource,for_next=1,extra_amount=50
actions+=/vanish,if=talent.shadow_focus.enabled&energy>=45&energy<=75&combo_points<=3&buff.shadow_dance.down&buff.master_of_subtlety.down&debuff.find_weakness.down
actions+=/pool_resource,for_next=1,extra_amount=90
actions+=/vanish,if=talent.subterfuge.enabled&energy>=90&combo_points<=3&buff.shadow_dance.down&buff.master_of_subtlety.down&debuff.find_weakness.down
actions+=/marked_for_death,if=combo_points=0
actions+=/run_action_list,name=generator,if=talent.anticipation.enabled&anticipation_charges<4&buff.slice_and_dice.up&dot.rupture.remains>2&(buff.slice_and_dice.remains<6|dot.rupture.remains<4)
actions+=/run_action_list,name=finisher,if=combo_points=5
actions+=/run_action_list,name=generator,if=combo_points<4|(combo_points=4&cooldown.honor_among_thieves.remains>1&energy>70-energy.regen)|talent.anticipation.enabled
actions+=/run_action_list,name=pool

# Combo point generators

actions.generator=run_action_list,name=pool,if=buff.master_of_subtlety.down&buff.shadow_dance.down&debuff.find_weakness.down&(energy+cooldown.shadow_dance.remains*energy.regen<80|energy+cooldown.vanish.remains*energy.regen<60)
actions.generator+=/fan_of_knives,if=active_enemies>1
actions.generator+=/shuriken_toss,if=energy<65&energy.regen<16
actions.generator+=/backstab
actions.generator+=/hemorrhage,if=position_front
actions.generator+=/run_action_list,name=pool

# Combo point finishers

actions.finisher=rupture,cycle_targets=1,if=(!ticking|remains<duration*0.3)&active_enemies<=3&(cooldown.death_from_above.remains>0|!talent.death_from_above.enabled)
actions.finisher+=/slice_and_dice,if=buff.slice_and_dice.remains<10.8&buff.slice_and_dice.remains<target.time_to_die
actions.finisher+=/death_from_above
actions.finisher+=/crimson_tempest,if=(active_enemies>=3&dot.crimson_tempest_dot.ticks_remain<=2&combo_points=5)|active_enemies>=5&(cooldown.death_from_above.remains>0|!talent.death_from_above.enabled)
actions.finisher+=/eviscerate,if=active_enemies<4|(active_enemies>3&dot.crimson_tempest_dot.ticks_remain>=2)&(cooldown.death_from_above.remains>0|!talent.death_from_above.enabled)
actions.finisher+=/run_action_list,name=pool

# Resource pooling

actions.pool=preparation,if=!buff.vanish.up&cooldown.vanish.remains>60

head=torias_perseverance,id=118894
neck=shifting_taladite_pendant,id=115800,bonus_id=190/527/540,enchant=75mult
shoulders=studded_frostboar_leather_spaulders,id=118890
back=cloak_of_creeping_necrosis,id=113657,bonus_id=566,enchant=gift_of_multistrike
chest=chestguard_of_determined_resolve,id=114497,bonus_id=52
wrists=exceptional_crystalhide_bracers,id=116962
hands=throatripper_gauntlets,id=113602,bonus_id=561/564/566,gems=50mult
waist=waistgirdle_of_the_mountain,id=118886
legs=nether_blast_leggings,id=113856
feet=sandals_of_mycoid_musing,id=113664,bonus_id=566
finger1=timeless_solium_band_of_the_assassin,id=118297,enchant=50mult
finger2=shifting_taladite_ring,id=115796,bonus_id=181/527/540,enchant=50mult
trinket1=skull_of_war,id=112318,bonus_id=525/529
trinket2=lucky_doublesided_coin,id=118876
main_hand=koraghs_boot_knife,id=113836,enchant=mark_of_bleeding_hollow
off_hand=felshanker,id=118738,bonus_id=524,enchant=mark_of_the_shattered_hand

# Gear Summary
# gear_agility=2331
# gear_stamina=3259
# gear_crit_rating=527
# gear_haste_rating=334
# gear_mastery_rating=815
# gear_armor=957
# gear_multistrike_rating=1022
# gear_versatility_rating=580

Shaerlyn

Shaerlyn : 27836 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
27835.5 27835.5 11.0 / 0.040% 3418.8 / 12.3% 56.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
463.2 463.2 Mana 0.00% 44.6 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Shaerlyn/advanced
Talents
  • 15: Astral Shift
  • 30: Windwalk Totem
  • 45: Totemic Projection
  • 60: Elemental Mastery
  • 75: Ancestral Guidance
  • 90: Unleashed Fury
  • 100: Elemental Fusion
  • Talent Calculator
Glyphs
  • Glyph of Chain Lightning
  • Glyph of Capacitor Totem
  • Glyph of Spiritwalker's Focus
  • Glyph of the Lakestrider
  • Glyph of Astral Recall
  • Glyph of Ghostly Speed
Professions
  • jewelcrafting: 710
  • enchanting: 700

Charts

http://0.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Shaerlyn+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x150&chd=t:50550|38701|37132|12848&chds=0,101101&chco=ABD473,C41F3B,C41F3B,ABD473&chm=t++50550++earth_shock,ABD473,0,0,15|t++38701++flame_shock,C41F3B,1,0,15|t++37132++lava_burst,C41F3B,2,0,15|t++12848++lightning_bolt,ABD473,3,0,15& http://1.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Shaerlyn+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:39,25,16,9,7,3,3,3,0&chds=0,100&chdls=ffffff&chco=C41F3B,ABD473,C41F3B,ABD473,C41F3B,ABD473,C41F3B,C41F3B,C41F3B&chl=lava_burst|lightning_bolt|molten_earth|fulmination|flame_shock|earth_shock|searing_totem: searing_bolt|greater_fire_elemental: melee|greater_fire_elemental: fire_blast&
http://3.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Shaerlyn+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:Xbeinqtwy25678520xxxvtroljhfebababbcbbbZYYYYXXWWWWVVVUUTTTTTTSSTTTUUUUUUUUUUUTTUUUUUUUUUTTTTTTTTTUUUVUVUUUTTTTUUUVVWWWXXXYYZZabcdeeeeeddcbaaaZZYYXXWVVUTTTTTTUUUUUUUUUUUUTTTTTTTTUVVWXXYZaabbcdeeeeeddccbbaaZYYXWVVUUUUVVVVVVVUUUUUUUUUUVVVVVWWWXXYZabccdeeeeeddccbbaaZZYXXWVUUTTTTTTUUUUUUUUTTTTTTTTTTTTTTTTTTTTTTTUUUUUVVUUUUUUUUUUUUVUUUUUUUUUVVUVVVVUUUUUUUUUUTUUUVVWWWXWVUTSRQPON&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.4198,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=27836|max=66307&chxp=1,1,42,100 http://6.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Shaerlyn+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:3,0,7,13,13,29,39,86,109,226,295,373,488,575,747,885,1039,1080,1235,1250,1413,1330,1345,1311,1244,1224,1156,1156,962,884,855,701,610,534,420,361,280,201,156,118,70,52,43,24,29,14,6,3,4,2&chds=0,1413&chbh=5&chxt=x&chxl=0:|min=24900|avg=27836|max=31208&chxp=0,1,47,100& http://2.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Shaerlyn+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:52.0,27.3,7.6,6.7,4.5,1.3,0.5&chds=0,100&chdls=ffffff&chco=ABD473,C41F3B,C41F3B,ABD473,C41F3B,C41F3B,C41F3B&chl=lightning_bolt 156.4s|lava_burst 82.2s|unleash_flame 23.0s|earth_shock 20.0s|flame_shock 13.5s|searing_totem 3.9s|fire_elemental_totem 1.5s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Shaerlyn 27836
earth_shock 907 (3370) 3.3% (12.1%) 16.2 18.18sec 62438 50550 Direct 16.2 9939 24834 12266 15.6% 14.8 4024 10046 15.6%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.22 16.22 0.00 0.00 1.2352 0.0000 272515.29 272515.29 0.00 50550.49 50550.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.31 15.58% 10046.46 5896 14949 9065.94 0 14949 23203 23203 0.00
multistrike 12.51 84.42% 4023.93 2358 5979 4027.67 2736 5112 50346 50346 0.00
hit 13.69 84.38% 9939.34 5823 14764 9948.84 7687 11796 136036 136036 0.00
crit 2.53 15.62% 24834.19 14558 36910 23207.01 0 36910 62930 62930 0.00
 
DPS Timeline Chart
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:mana
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:400.0
  • cooldown:5.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.lightning_shield.react=buff.lightning_shield.max_stack
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing {$s1=1119} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.925000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    fulmination 2464 8.9% 16.2 18.18sec 45637 0 Direct 16.2 26980 67432 33287 15.6% 14.9 10922 27322 15.5%  

Stats details: fulmination

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.22 16.22 0.00 0.00 0.0000 0.0000 740263.85 740263.85 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.30 15.49% 27322.00 21633 38599 24640.47 0 38599 62971 62971 0.00
multistrike 12.58 84.51% 10922.38 8653 15440 10936.44 0 13111 137363 137363 0.00
hit 13.69 84.41% 26979.60 21366 38123 27015.64 23844 30750 369393 369393 0.00
crit 2.53 15.59% 67432.15 53415 95307 63035.08 0 95307 170538 170538 0.00
 
DPS Timeline Chart
 

Action details: fulmination

Static Values
  • id:88766
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:3.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:26364
  • name:Lightning Shield
  • school:nature
  • tooltip:
  • description:Discharges lightning at an attacker, dealing {$s1=274} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.226305
  • base_dd_min:0.00
  • base_dd_max:0.00
 
flame_shock 1747 6.3% 10.7 29.19sec 48829 38701 Direct 10.7 4198 10496 5177 15.5% 9.7 1697 4237 15.6%  
Periodic 123.6 2144 5361 2645 15.6% 113.4 869 2172 15.6% 98.9%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.74 10.74 123.56 123.56 1.2617 2.4095 524278.84 524278.84 0.00 1684.37 38700.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.51 15.59% 4237.40 2232 6774 3323.32 0 6774 6402 6402 0.00
multistrike 8.18 84.41% 1697.42 893 2709 1700.92 0 2709 13885 13885 0.00
hit 9.07 84.46% 4198.35 2204 6690 4206.98 2953 5540 38075 38075 0.00
crit 1.67 15.54% 10496.02 5510 16725 8751.49 0 16725 17508 17508 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 17.7 15.60% 2171.85 1116 3388 2175.68 1285 3039 38424 38424 0.00
multistrike 95.7 84.40% 868.78 447 1355 870.34 649 1098 83178 83178 0.00
hit 104.3 84.43% 2144.01 17 3346 2147.88 1615 2734 223657 223657 0.00
crit 19.2 15.57% 5361.01 21 8366 5370.91 3574 7105 103150 103150 0.00
 
DPS Timeline Chart
 

Action details: flame_shock

Static Values
  • id:8050
  • school:fire
  • resource:mana
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:400.0
  • cooldown:5.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains<=9
Spelldata
  • id:8050
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=424} Fire damage and then an additional $o1 Fire damage over {$d=30 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.350000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.175000
  • base_td:1.00
  • dot_duration:30.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
lava_burst 10204 36.5% 59.9 4.97sec 50918 37132 Direct 59.8 0 35264 35264 100.0% 65.9 0 14305 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.94 59.83 0.00 0.00 1.3713 0.0000 3052038.62 3052038.62 0.00 37132.13 37132.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 65.85 100.00% 14304.95 10933 20281 14313.00 13113 15603 942024 942024 0.00
crit 59.83 100.00% 35264.46 26995 50076 35284.01 33484 37121 2110014 2110014 0.00
 
DPS Timeline Chart
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:160.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&(buff.ascendance.up|cooldown_react)
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=932} Fire damage. Lava Burst will always deal a critical strike. If your Flame Shock is on the target, Lava Burst will deal $8050m3% additional damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.770000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
lightning_bolt 6667 24.0% 94.8 2.94sec 21197 12848 Direct 94.5 12613 31523 15568 15.6% 85.4 5109 12767 15.6%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.79 94.50 0.00 0.00 1.6498 0.0000 2009251.23 2009251.23 0.00 12848.35 12848.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 13.32 15.61% 12766.63 10489 16425 12768.88 10489 15726 170088 170088 0.00
multistrike 72.03 84.39% 5108.95 4196 6570 5110.39 4771 5529 368010 368010 0.00
hit 79.73 84.37% 12612.70 10360 16222 12616.19 11974 13183 1005626 1005626 0.00
crit 14.77 15.63% 31523.13 25899 40556 31529.53 25899 38251 465526 465526 0.00
 
DPS Timeline Chart
 

Action details: lightning_bolt

Static Values
  • id:403
  • school:nature
  • resource:mana
  • range:30.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:560.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:403
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Fires a bolt of lightning at the target, dealing {$s1=1065} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.880000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
molten_earth 4286 15.4% 124.5 2.40sec 10345 0 Direct 124.0 6145 15368 7585 15.6% 113.0 2492 6226 15.6%  

Stats details: molten_earth

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 124.45 123.97 0.00 0.00 0.0000 0.0000 1287466.76 1287466.76 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 17.58 15.56% 6225.98 5741 8087 6230.91 5741 7208 109471 109471 0.00
multistrike 95.41 84.44% 2491.60 2296 3235 2493.51 2381 2644 237715 237715 0.00
hit 104.62 84.39% 6144.71 5670 7988 6149.46 5929 6425 642834 642834 0.00
crit 19.36 15.61% 15367.65 14176 19969 15378.48 14176 17796 297447 297447 0.00
 
DPS Timeline Chart
 

Action details: molten_earth

Static Values
  • id:170379
  • school:fire
  • resource:none
  • range:45.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:170379
  • name:Molten Earth
  • school:fire
  • tooltip:
  • description:{$@spelldesc170374=Your damaging spells incite the earth around you to come to your aid for {$170377d=6 seconds}, repeatedly dealing ${($m1/100)*($170379m1+{$170379m2=0})/2} Fire damage to your most recently attacked target. Also increases the damage of your Earthquake by {$s3=0}%.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_fire_elemental 2892 / 721
fire_blast 207 0.2% 12.7 15.54sec 1246 0 Direct 12.7 792 1982 976 15.5% 11.7 238 596 15.5%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.71 12.71 0.00 0.00 0.0000 0.0000 15832.58 15832.58 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.81 15.54% 596.42 542 763 496.17 0 763 1080 1080 0.00
multistrike 9.84 84.46% 238.29 217 305 239.81 0 305 2345 2345 0.00
hit 10.74 84.50% 791.85 722 1017 796.50 722 899 8504 8504 0.00
crit 1.97 15.50% 1981.61 1806 2544 1721.55 0 2544 3904 3904 0.00
 
DPS Timeline Chart
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.459030
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 2685 2.4% 72.3 2.58sec 2799 2848 Direct 72.3 1778 4446 2194 15.6% 66.2 535 1338 15.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.29 72.29 0.00 0.00 0.9830 0.0000 202336.76 202336.76 0.00 2847.61 2847.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 10.34 15.61% 1337.77 1180 1662 1344.52 0 1662 13837 13837 0.00
multistrike 55.90 84.39% 535.09 472 665 537.90 490 593 29911 29911 0.00
hit 61.02 84.41% 1778.10 1574 2217 1787.32 1665 1888 108501 108501 0.00
crit 11.27 15.59% 4445.83 3934 5541 4469.15 3934 5541 50087 50087 0.00
 
DPS Timeline Chart
 

Action details: melee

Static Values
  • id:0
  • school:fire
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.40
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - searing_totem 1214 / 840
searing_bolt 1214 3.0% 121.0 1.85sec 2080 0 Direct 120.7 1329 3323 1639 15.5% 109.6 399 997 15.6%  

Stats details: searing_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 120.99 120.68 0.00 0.00 0.0000 0.0000 251714.60 251714.60 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 17.07 15.58% 996.70 945 1138 996.42 945 1106 17017 17017 0.00
multistrike 92.51 84.42% 398.80 378 455 398.67 382 415 36893 36893 0.00
hit 101.93 84.46% 1329.35 1260 1517 1328.94 1288 1367 135495 135495 0.00
crit 18.75 15.54% 3322.62 3150 3794 3321.47 3150 3650 62309 62309 0.00
 
DPS Timeline Chart
 

Action details: searing_bolt

Static Values
  • id:3606
  • school:fire
  • resource:none
  • range:25.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3606
  • name:Searing Bolt
  • school:fire
  • tooltip:
  • description:Deals Fire damage to the target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
Shaerlyn
ascendance 2.0 181.24sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.02 2.02 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.71 84.37% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.32 15.63% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: ascendance

Static Values
  • id:165339
  • school:physical
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:1664.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:active_enemies>1|(dot.flame_shock.remains>buff.ascendance.duration&(target.time_to_die<20|buff.bloodlust.up|time>=60)&cooldown.lava_burst.remains>0)
Spelldata
  • id:165339
  • name:Ascendance
  • school:physical
  • tooltip:
  • description:The Shaman transforms into a Flame Ascendant for {$114051d=15 seconds}. While in this form, Lava Burst has no cooldown and Chain Lightning is empowered to become Lava Beam.
 
draenic_intellect_potion 2.0 0.00sec

Stats details: draenic_intellect_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156426
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156426
  • name:Draenic Intellect Potion
  • school:physical
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
 
elemental_mastery 3.0 121.14sec

Stats details: elemental_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: elemental_mastery

Static Values
  • id:16166
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:action.lava_burst.cast_time>=1.2
Spelldata
  • id:16166
  • name:Elemental Mastery
  • school:nature
  • tooltip:Haste increased by {$s1=30}%.
  • description:Elemental forces empower you with {$s1=30}% haste for {$d=20 seconds}.
 
fire_elemental_totem 1.5 0.00sec

Stats details: fire_elemental_totem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.50 1.50 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.50 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: fire_elemental_totem

Static Values
  • id:2894
  • school:fire
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:8607.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!active
Spelldata
  • id:2894
  • name:Fire Elemental Totem
  • school:fire
  • tooltip:
  • description:Summons a Fire Totem with {$s1=1} health at the feet of the caster, calling forth a Greater Fire Elemental to rain destruction on the caster's enemies. Lasts {$d=60 seconds}.
 
lightning_shield 1.0 0.00sec

Stats details: lightning_shield

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.85 84.59% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.15 15.41% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: lightning_shield

Static Values
  • id:324
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.lightning_shield.up
Spelldata
  • id:324
  • name:Lightning Shield
  • school:nature
  • tooltip:Deals Nature damage to attackers.
  • description:The caster is surrounded by a reactive lightning barrier. When an attack hits the caster, the attacker will be struck for {$26364s1=274} Nature damage. This effect may only occur once every few seconds. Lasts {$d=3600 seconds}.
 
searing_totem 3.9 65.98sec

Stats details: searing_totem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.88 3.88 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.88 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: searing_totem

Static Values
  • id:3599
  • school:fire
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:960.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!talent.liquid_magma.enabled&!totem.fire.active)|(talent.liquid_magma.enabled&pet.searing_totem.remains<=20&!pet.fire_elemental_totem.active&!buff.liquid_magma.up)
Spelldata
  • id:3599
  • name:Searing Totem
  • school:fire
  • tooltip:
  • description:Summons a Fire Totem with {$?s63298=false}[{$s1=5}% of the caster's][{$s1=5}] health at the feet of the caster for {$d=60 seconds} that repeatedly attacks an enemy within $3606r1 yards for {$3606s1=243} Fire damage.
 
unleash_flame 18.5 16.68sec

Stats details: unleash_flame

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.49 18.49 0.00 0.00 1.2448 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.49 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: unleash_flame

Static Values
  • id:165462
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1120.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:165462
  • name:Unleash Flame
  • school:fire
  • tooltip:Damage dealt by the next Fire spell increased by $w2%.
  • description:Unleashes elemental forces of Flame, increasing the damage dealt by the Shaman's next Fire spell by {$s2=40}%.
 
wind_shear 8.4 37.62sec

Stats details: wind_shear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.40 8.40 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.40 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: wind_shear

Static Values
  • id:57994
  • school:nature
  • resource:mana
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:3008.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57994
  • name:Wind Shear
  • school:nature
  • tooltip:
  • description:Disrupts the target's concentration with a burst of wind, interrupting spellcasting and preventing any spell in that school from being cast for {$d=3 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
ascendance 2.0 0.0 181.2sec 181.2sec 10.16% 10.17% 0.0(0.0)

Buff details

  • buff initial source:Shaerlyn
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • ascendance_1:10.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Autoattacks have a $114089r yard range. Stormstrike is empowered and has a $114089r yard range.
  • description:The Shaman surrenders $ghis:her; physical form to the power of the elements, transforming into a being of raw elemental energy for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 32.88% 0.0(0.0)

Buff details

  • buff initial source:Shaerlyn
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
draenic_intellect_potion 2.0 0.0 185.5sec 0.0sec 15.21% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Shaerlyn
  • cooldown name:buff_draenic_intellect_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:1000.00

Stack Uptimes

  • draenic_intellect_potion_1:15.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156426
  • name:Draenic Intellect Potion
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
elemental_fusion 23.1 36.7 13.0sec 5.0sec 56.84% 83.67% 22.4(22.4)

Buff details

  • buff initial source:Shaerlyn
  • cooldown name:buff_elemental_fusion
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • elemental_fusion_1:32.96%
  • elemental_fusion_2:23.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:157174
  • name:Elemental Fusion
  • tooltip:Damage of your next Shock increased by $w1%.
  • description:{$@spelldesc152257=Your Lava Burst and Lava Lash increase the damage of your next Shock by {$157174s1=40}%, stacking up to 2 times.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
elemental_mastery 3.0 0.0 121.1sec 121.2sec 19.24% 40.94% 0.0(0.0)

Buff details

  • buff initial source:Shaerlyn
  • cooldown name:buff_elemental_mastery
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • elemental_mastery_1:19.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:16166
  • name:Elemental Mastery
  • tooltip:Haste increased by {$s1=30}%.
  • description:Elemental forces empower you with {$s1=30}% haste for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
enhanced_unleash 18.5 0.0 16.7sec 16.7sec 24.41% 24.43% 0.0(0.0)

Buff details

  • buff initial source:Shaerlyn
  • cooldown name:buff_enhanced_unleash
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • enhanced_unleash_1:24.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162557
  • name:Enhanced Unleash
  • tooltip:Movement speed increased by {$s1=30}%.
  • description:{$@spelldesc157784=Your {$?s165462=true}[Unleash Flame]?s73685[Unleash Life][Unleash Elements] ability also causes you to gain {$162557s1=30}% increased movement speed for {$162557d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
lava_surge 24.5 0.1 11.9sec 11.8sec 10.19% 43.93% 0.1(0.1)

Buff details

  • buff initial source:Shaerlyn
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • lava_surge_1:10.19%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77756
  • name:Lava Surge
  • tooltip:
  • description:Your Flame Shock damage over time has a chance to reset the cooldown of your Lava Burst spell and cause your next Lava Burst spell to be instant.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:20.00%
mark_of_the_frostwolf 13.5 4.1 22.8sec 17.2sec 30.99% 31.00% 1.0(1.0)

Buff details

  • buff initial source:Shaerlyn
  • cooldown name:buff_mark_of_the_frostwolf
  • max_stacks:2
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stat Buff details

  • stat:multistrike_rating
  • amount:500.00

Stack Uptimes

  • mark_of_the_frostwolf_1:23.71%
  • mark_of_the_frostwolf_2:7.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:159676
  • name:Mark of the Frostwolf
  • tooltip:Multistrike increased by $w1.
  • description:Increases multistrike by {$s1=500}.
  • max_stacks:2
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
sudden_clarity 3.0 0.0 120.8sec 120.9sec 19.29% 19.31% 0.0(0.0)

Buff details

  • buff initial source:Shaerlyn
  • cooldown name:buff_sudden_clarity
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:spell_power
  • amount:1100.00

Stack Uptimes

  • sudden_clarity_1:19.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:177594
  • name:Sudden Clarity
  • tooltip:Increases spellpower by {$s1=653}.
  • description:Increases your spellpower by {$s1=653} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
unleash_flame 18.5 0.0 16.7sec 16.7sec 25.98% 25.69% 0.0(0.0)

Buff details

  • buff initial source:Shaerlyn
  • cooldown name:buff_unleash_flame
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • unleash_flame_1:25.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:73683
  • name:Unleash Flame
  • tooltip:Damage dealt by the next Fire spell increased by $w2%.
  • description:Unleashes the Flametongue enchantment upon the Shaman's weapon, increasing the damage dealt by the Shaman's next Fire spell by {$s2=40}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
unleashed_fury 18.5 0.0 16.7sec 16.7sec 60.40% 64.08% 0.0(0.0)

Buff details

  • buff initial source:Shaerlyn
  • cooldown name:buff_unleashed_fury
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • unleashed_fury_1:60.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118470
  • name:Unleashed Fury
  • tooltip:Increases damage dealt by Lightning Bolt by {$s1=30}% and Lava Burst by {$s2=10}%.
  • description:Increases the damage dealt by your Lightning Bolt by {$s1=30}% and Lava Burst by {$s2=10}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_intellect_flask

Buff details

  • buff initial source:Shaerlyn
  • cooldown name:buff_greater_draenic_intellect_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:250.00

Stack Uptimes

  • greater_draenic_intellect_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156079
  • name:Greater Draenic Intellect Flask
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
lightning_shield

Buff details

  • buff initial source:Shaerlyn
  • cooldown name:buff_lightning_shield
  • max_stacks:20
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • lightning_shield_1:11.01%
  • lightning_shield_2:3.66%
  • lightning_shield_3:7.03%
  • lightning_shield_4:5.79%
  • lightning_shield_5:4.89%
  • lightning_shield_6:5.15%
  • lightning_shield_7:5.09%
  • lightning_shield_8:5.16%
  • lightning_shield_9:5.23%
  • lightning_shield_10:5.21%
  • lightning_shield_11:5.19%
  • lightning_shield_12:5.15%
  • lightning_shield_13:5.13%
  • lightning_shield_14:5.04%
  • lightning_shield_15:5.02%
  • lightning_shield_16:4.18%
  • lightning_shield_17:3.63%
  • lightning_shield_18:2.77%
  • lightning_shield_19:2.07%
  • lightning_shield_20:3.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:324
  • name:Lightning Shield
  • tooltip:Deals Nature damage to attackers.
  • description:The caster is surrounded by a reactive lightning barrier. When an attack hits the caster, the attacker will be struck for {$26364s1=274} Nature damage. This effect may only occur once every few seconds. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Shaerlyn
ascendance Mana 2.0 3368.5 1664.0 1664.0 0.0
earth_shock Mana 16.2 6488.2 400.0 400.0 156.1
fire_elemental_totem Mana 1.5 12868.2 8607.0 8606.5 0.0
flame_shock Mana 10.7 4294.8 400.0 400.0 122.1
lava_burst Mana 59.9 9590.3 160.0 160.0 318.2
lightning_bolt Mana 94.8 53082.2 560.0 560.0 37.9
searing_totem Mana 3.9 3720.1 960.0 960.0 0.0
unleash_flame Mana 18.5 20709.0 1120.0 1120.0 0.0
wind_shear Mana 8.4 25275.3 3008.0 3008.0 0.0
Resource Gains Type Count Total Average Overflow
external_healing Health 8.06 0.00 (0.00%) 0.00 75927.03 100.00%
mp5_regen Mana 205.22 138637.59 (100.00%) 675.55 226361.84 62.02%
Resource RPS-Gain RPS-Loss
Mana 460.69 463.21
Combat End Resource Mean Min Max
Mana 159229.53 150800.62 160000.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 57.7%
primal_fire_elemental-Mana Cap 57.7%
greater_fire_elemental-Mana Cap 57.7%
primal_storm_elemental-Mana Cap 57.7%
greater_storm_elemental-Mana Cap 57.7%
primal_earth_elemental-Mana Cap 57.7%
greater_earth_elemental-Mana Cap 57.7%
lightning_elemental-Mana Cap 57.7%
earth_elemental_totem-Mana Cap 57.7%
fire_elemental_totem-Mana Cap 57.7%
storm_elemental_totem-Mana Cap 57.7%
magma_totem-Mana Cap 57.7%
searing_totem-Mana Cap 57.7%

Procs

Count Interval
Elemental Fusion: Earth Shock 16.2 18.2sec
Elemental Fusion: Flame Shock 10.7 29.2sec
lava_surge 24.7 11.8sec
uf_flame_shock 5.7 51.2sec
uf_lava_burst 12.5 21.9sec
wasted_lava_surge 0.2 73.5sec
wasted_lightning_shield 12.4 35.8sec
lava_surge_during_lvb 4.9 51.3sec
Fulmination: 15 stacks 2.4 69.9sec
Fulmination: 16 stacks 2.5 69.1sec
Fulmination: 17 stacks 2.3 72.7sec
Fulmination: 18 stacks 1.9 78.5sec
Fulmination: 19 stacks 7.3 40.1sec
Fulmination: Generate 305.5 1.9sec

Statistics & Data Analysis

Fight Length
Sample Data Shaerlyn Fight Length
Count 25000
Mean 300.94
Minimum 230.43
Maximum 374.11
Spread ( max - min ) 143.68
Range [ ( max - min ) / 2 * 100% ] 23.87%
DPS
Sample Data Shaerlyn Damage Per Second
Count 25000
Mean 27835.52
Minimum 24900.46
Maximum 31207.84
Spread ( max - min ) 6307.38
Range [ ( max - min ) / 2 * 100% ] 11.33%
Standard Deviation 890.5949
5th Percentile 26433.05
95th Percentile 29353.09
( 95th Percentile - 5th Percentile ) 2920.04
Mean Distribution
Standard Deviation 5.6326
95.00% Confidence Intervall ( 27824.48 - 27846.56 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3932
0.1 Scale Factor Error with Delta=300 6770
0.05 Scale Factor Error with Delta=300 27083
0.01 Scale Factor Error with Delta=300 677086
Distribution Chart
DPS(e)
Sample Data Shaerlyn Damage Per Second (Effective)
Count 25000
Mean 27835.52
Minimum 24900.46
Maximum 31207.84
Spread ( max - min ) 6307.38
Range [ ( max - min ) / 2 * 100% ] 11.33%
Damage
Sample Data Shaerlyn Damage
Count 25000
Mean 7885814.60
Minimum 5892072.54
Maximum 9976642.59
Spread ( max - min ) 4084570.05
Range [ ( max - min ) / 2 * 100% ] 25.90%
DTPS
Sample Data Shaerlyn Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Shaerlyn Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Shaerlyn Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Shaerlyn Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Shaerlyn Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Shaerlyn Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data ShaerlynTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Shaerlyn Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_intellect_flask
1 0.00 food,type=calamari_crepes
2 0.00 lightning_shield,if=!buff.lightning_shield.up
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=draenic_intellect
Default action list Executed every time the actor is available.
# count action,conditions
5 8.40 wind_shear
6 0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 3.01 use_item,name=copelands_clarity
8 1.00 potion,name=draenic_intellect,if=buff.ascendance.up|target.time_to_die<=30
In-combat potion is preferentially linked to Ascendance, unless combat will end shortly
9 0.00 berserking,if=!buff.bloodlust.up&!buff.elemental_mastery.up&(set_bonus.tier15_4pc_caster=1|(buff.ascendance.cooldown_remains=0&(dot.flame_shock.remains>buff.ascendance.duration|level<87)))
A 0.00 blood_fury,if=buff.bloodlust.up|buff.ascendance.up|((cooldown.ascendance.remains>10|level<87)&cooldown.fire_elemental_totem.remains>10)
B 0.00 arcane_torrent
C 3.00 elemental_mastery,if=action.lava_burst.cast_time>=1.2
D 0.00 ancestral_swiftness,if=!buff.ascendance.up
E 0.00 storm_elemental_totem
F 1.50 fire_elemental_totem,if=!active
G 2.02 ascendance,if=active_enemies>1|(dot.flame_shock.remains>buff.ascendance.duration&(target.time_to_die<20|buff.bloodlust.up|time>=60)&cooldown.lava_burst.remains>0)
H 0.00 liquid_magma,if=pet.searing_totem.remains>=15|pet.fire_elemental_totem.remains>=15
I 0.00 call_action_list,name=single,if=active_enemies=1
If only one enemy, priority follows the 'single' action list.
J 0.00 call_action_list,name=aoe,if=active_enemies>1
On multiple enemies, the priority follows the 'aoe' action list.
actions.single Single target action priority list
# count action,conditions
K 0.00 unleash_flame,moving=1
L 0.00 spiritwalkers_grace,moving=1,if=buff.ascendance.up
M 5.15 earth_shock,if=buff.lightning_shield.react=buff.lightning_shield.max_stack
N 60.06 lava_burst,if=dot.flame_shock.remains>cast_time&(buff.ascendance.up|cooldown_react)
O 18.49 unleash_flame,if=talent.unleashed_fury.enabled&!buff.ascendance.up
P 10.13 flame_shock,if=dot.flame_shock.remains<=9
Q 11.07 earth_shock,if=(set_bonus.tier17_4pc&buff.lightning_shield.react>=15&!buff.lava_surge.up)|(!set_bonus.tier17_4pc&buff.lightning_shield.react>15)
R 0.00 earthquake,if=!talent.unleashed_fury.enabled&((1+stat.spell_haste)*(1+(mastery_value*2%4.5))>=(1.875+(1.25*0.226305)+1.25*(2*0.226305*stat.multistrike_pct%100)))&target.time_to_die>10&buff.elemental_mastery.down&buff.bloodlust.down
S 0.00 earthquake,if=!talent.unleashed_fury.enabled&((1+stat.spell_haste)*(1+(mastery_value*2%4.5))>=1.3*(1.875+(1.25*0.226305)+1.25*(2*0.226305*stat.multistrike_pct%100)))&target.time_to_die>10&(buff.elemental_mastery.up|buff.bloodlust.up)
T 0.00 earthquake,if=!talent.unleashed_fury.enabled&((1+stat.spell_haste)*(1+(mastery_value*2%4.5))>=(1.875+(1.25*0.226305)+1.25*(2*0.226305*stat.multistrike_pct%100)))&target.time_to_die>10&(buff.elemental_mastery.remains>=10|buff.bloodlust.remains>=10)
U 0.00 earthquake,if=talent.unleashed_fury.enabled&((1+stat.spell_haste)*(1+(mastery_value*2%4.5))>=((1.3*1.875)+(1.25*0.226305)+1.25*(2*0.226305*stat.multistrike_pct%100)))&target.time_to_die>10&buff.elemental_mastery.down&buff.bloodlust.down
V 0.00 earthquake,if=talent.unleashed_fury.enabled&((1+stat.spell_haste)*(1+(mastery_value*2%4.5))>=1.3*((1.3*1.875)+(1.25*0.226305)+1.25*(2*0.226305*stat.multistrike_pct%100)))&target.time_to_die>10&(buff.elemental_mastery.up|buff.bloodlust.up)
W 0.00 earthquake,if=talent.unleashed_fury.enabled&((1+stat.spell_haste)*(1+(mastery_value*2%4.5))>=((1.3*1.875)+(1.25*0.226305)+1.25*(2*0.226305*stat.multistrike_pct%100)))&target.time_to_die>10&(buff.elemental_mastery.remains>=10|buff.bloodlust.remains>=10)
X 0.00 elemental_blast
Y 0.61 flame_shock,if=time>60&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<duration
After the initial Ascendance, use Flame Shock pre-emptively just before Ascendance to guarantee Flame Shock staying up for the full duration of the Ascendance buff
Z 3.88 searing_totem,if=(!talent.liquid_magma.enabled&!totem.fire.active)|(talent.liquid_magma.enabled&pet.searing_totem.remains<=20&!pet.fire_elemental_totem.active&!buff.liquid_magma.up)
Keep Searing Totem up, unless Fire Elemental Totem is coming off cooldown in the next 20 seconds
a 0.00 spiritwalkers_grace,moving=1,if=((talent.elemental_blast.enabled&cooldown.elemental_blast.remains=0)|(cooldown.lava_burst.remains=0&!buff.lava_surge.react))
b 95.35 lightning_bolt

Sample Sequence

01247CFOPN5NGNNNNNNNNNNMNNNNObPNbNbNQbbbbONbb5bQbNbbbOPNbbQZbbNObbbNb5QbbNOPbbbNbbNQObbbNbbNPb5NON7CbQZbbNbbbNbObNQbbbPbNbObb5bNQbNbbObbNYbbNQbOZbNG8NNN5NNNNMNNOPbNbbbbNNOMbbbN5bbPbONb7CQbZbNbbNbObQbbNNbbNPb5NOQbbbNbNbbObbNQbb

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 160000.0/160000: 100% mana
Pre food Fluffy_Pillow 160000.0/160000: 100% mana
Pre lightning_shield Fluffy_Pillow 160000.0/160000: 100% mana
Pre potion Fluffy_Pillow 160000.0/160000: 100% mana draenic_intellect_potion
0:00.000 use_item_copelands_clarity Fluffy_Pillow 160000.0/160000: 100% mana draenic_intellect_potion
0:00.000 elemental_mastery Fluffy_Pillow 160000.0/160000: 100% mana draenic_intellect_potion, sudden_clarity
0:00.000 fire_elemental_totem Fluffy_Pillow 160000.0/160000: 100% mana elemental_mastery, draenic_intellect_potion, sudden_clarity
0:01.004 unleash_flame Fluffy_Pillow 152613.9/160000: 95% mana bloodlust, elemental_mastery, draenic_intellect_potion, sudden_clarity
0:02.007 flame_shock Fluffy_Pillow 152713.5/160000: 95% mana bloodlust, unleash_flame, unleashed_fury, elemental_mastery, enhanced_unleash, draenic_intellect_potion, sudden_clarity
0:03.012 lava_burst Fluffy_Pillow 153535.6/160000: 96% mana bloodlust, unleashed_fury, elemental_mastery, enhanced_unleash, mark_of_the_frostwolf, draenic_intellect_potion, sudden_clarity
0:04.062 wind_shear Fluffy_Pillow 154652.4/160000: 97% mana bloodlust, lava_surge, unleashed_fury, elemental_mastery, enhanced_unleash, mark_of_the_frostwolf, draenic_intellect_potion, sudden_clarity
0:04.062 lava_burst Fluffy_Pillow 151644.4/160000: 95% mana bloodlust, lava_surge, unleashed_fury, elemental_mastery, enhanced_unleash, mark_of_the_frostwolf, draenic_intellect_potion, sudden_clarity
0:05.065 ascendance Fluffy_Pillow 152704.0/160000: 95% mana bloodlust, elemental_fusion(2), unleashed_fury, elemental_mastery, mark_of_the_frostwolf, draenic_intellect_potion, sudden_clarity
0:05.065 lava_burst Fluffy_Pillow 151040.0/160000: 94% mana bloodlust, ascendance, elemental_fusion(2), unleashed_fury, elemental_mastery, mark_of_the_frostwolf, draenic_intellect_potion, sudden_clarity
0:06.116 lava_burst Fluffy_Pillow 152158.1/160000: 95% mana bloodlust, ascendance, lava_surge, elemental_fusion(2), unleashed_fury, elemental_mastery, mark_of_the_frostwolf, draenic_intellect_potion, sudden_clarity
0:07.121 lava_burst Fluffy_Pillow 153220.1/160000: 96% mana bloodlust, ascendance, lava_surge, elemental_fusion(2), unleashed_fury, elemental_mastery, mark_of_the_frostwolf, draenic_intellect_potion, sudden_clarity
0:08.124 lava_burst Fluffy_Pillow 154279.8/160000: 96% mana bloodlust, ascendance, elemental_fusion(2), unleashed_fury, elemental_mastery, draenic_intellect_potion, sudden_clarity
0:09.175 lava_burst Fluffy_Pillow 155397.8/160000: 97% mana bloodlust, ascendance, elemental_fusion(2), unleashed_fury, elemental_mastery, draenic_intellect_potion, sudden_clarity
0:10.226 lava_burst Fluffy_Pillow 156515.8/160000: 98% mana bloodlust, ascendance, elemental_fusion(2), unleashed_fury, elemental_mastery, draenic_intellect_potion, sudden_clarity
0:11.276 lava_burst Fluffy_Pillow 157632.6/160000: 99% mana bloodlust, ascendance, elemental_fusion(2), elemental_mastery, draenic_intellect_potion, sudden_clarity
0:12.327 lava_burst Fluffy_Pillow 158750.6/160000: 99% mana bloodlust, ascendance, elemental_fusion(2), elemental_mastery, draenic_intellect_potion, sudden_clarity
0:13.376 lava_burst Fluffy_Pillow 159866.2/160000: 100% mana bloodlust, ascendance, elemental_fusion(2), elemental_mastery, draenic_intellect_potion, sudden_clarity
0:14.427 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, ascendance, elemental_fusion(2), elemental_mastery, draenic_intellect_potion, sudden_clarity
0:15.477 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, ascendance, lava_surge, elemental_fusion(2), elemental_mastery, draenic_intellect_potion, sudden_clarity
0:16.479 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, ascendance, lava_surge, elemental_fusion, elemental_mastery, draenic_intellect_potion, sudden_clarity
0:17.484 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, ascendance, elemental_fusion(2), elemental_mastery, draenic_intellect_potion, sudden_clarity
0:18.535 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, ascendance, elemental_fusion(2), elemental_mastery, draenic_intellect_potion, sudden_clarity
0:19.586 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, ascendance, elemental_fusion(2), elemental_mastery, draenic_intellect_potion, sudden_clarity
0:20.636 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, elemental_fusion(2)
0:21.660 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, elemental_fusion(2), unleash_flame, unleashed_fury, enhanced_unleash
0:23.024 flame_shock Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, lava_surge, elemental_fusion(2), unleash_flame, unleashed_fury, enhanced_unleash
0:24.051 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, lava_surge, unleashed_fury, enhanced_unleash
0:25.076 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, lava_surge, elemental_fusion, unleashed_fury, mark_of_the_frostwolf
0:26.439 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, lava_surge, elemental_fusion, unleashed_fury, mark_of_the_frostwolf
0:27.463 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, lava_surge, elemental_fusion(2), unleashed_fury, mark_of_the_frostwolf
0:28.826 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, lava_surge, elemental_fusion(2), unleashed_fury, mark_of_the_frostwolf
0:29.852 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, elemental_fusion(2), unleashed_fury, mark_of_the_frostwolf
0:30.876 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, mark_of_the_frostwolf
0:32.239 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust
0:33.603 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust
0:34.968 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust
0:36.332 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana bloodlust
0:37.356 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, unleash_flame, unleashed_fury, enhanced_unleash
0:38.723 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, unleashed_fury, enhanced_unleash
0:40.088 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, elemental_fusion, unleashed_fury, enhanced_unleash
0:41.451 wind_shear Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury
0:41.451 lightning_bolt Fluffy_Pillow 156992.0/160000: 98% mana elemental_fusion, unleashed_fury
0:43.224 earth_shock Fluffy_Pillow 158588.0/160000: 99% mana elemental_fusion, unleashed_fury
0:44.553 lightning_bolt Fluffy_Pillow 159804.0/160000: 100% mana lava_surge, unleashed_fury
0:46.324 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, unleashed_fury
0:47.654 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion
0:49.428 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion
0:51.200 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion
0:52.974 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion
0:54.305 flame_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleash_flame, unleashed_fury, enhanced_unleash
0:55.636 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, enhanced_unleash
0:57.408 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury
0:59.183 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury, mark_of_the_frostwolf
1:00.956 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury, mark_of_the_frostwolf
1:02.287 searing_totem Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, mark_of_the_frostwolf
1:03.293 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana mark_of_the_frostwolf
1:05.067 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana mark_of_the_frostwolf
1:06.839 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana
1:08.612 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana
1:09.944 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleash_flame, unleashed_fury, enhanced_unleash
1:11.716 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleash_flame, unleashed_fury, enhanced_unleash
1:13.488 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion, unleash_flame, unleashed_fury
1:15.258 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion, unleash_flame, unleashed_fury
1:16.586 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleashed_fury
1:18.359 wind_shear Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleashed_fury
1:18.359 earth_shock Fluffy_Pillow 156992.0/160000: 98% mana elemental_fusion(2), unleashed_fury
1:19.691 lightning_bolt Fluffy_Pillow 158211.7/160000: 99% mana
1:21.465 lightning_bolt Fluffy_Pillow 159808.9/160000: 100% mana lava_surge
1:23.236 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge
1:24.568 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion
1:25.898 flame_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleash_flame, unleashed_fury, enhanced_unleash
1:27.229 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, enhanced_unleash
1:29.001 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, mark_of_the_frostwolf
1:30.774 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, mark_of_the_frostwolf
1:32.546 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, mark_of_the_frostwolf(2)
1:34.318 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, mark_of_the_frostwolf(2)
1:36.092 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, mark_of_the_frostwolf(2)
1:37.863 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion
1:39.192 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2)
1:40.522 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana
1:41.852 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury, enhanced_unleash
1:43.623 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury, enhanced_unleash
1:45.393 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury
1:47.165 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury
1:48.938 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury
1:50.712 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion
1:52.485 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion
1:53.814 flame_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), mark_of_the_frostwolf
1:55.144 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana mark_of_the_frostwolf
1:56.915 wind_shear Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, mark_of_the_frostwolf(2)
1:56.915 lava_burst Fluffy_Pillow 156992.0/160000: 98% mana lava_surge, mark_of_the_frostwolf(2)
1:58.245 unleash_flame Fluffy_Pillow 158449.3/160000: 99% mana lava_surge, elemental_fusion, mark_of_the_frostwolf(2)
1:59.575 lava_burst Fluffy_Pillow 158946.6/160000: 99% mana lava_surge, elemental_fusion, unleash_flame, unleashed_fury, enhanced_unleash, mark_of_the_frostwolf(2)
2:00.907 use_item_copelands_clarity Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleashed_fury, enhanced_unleash, mark_of_the_frostwolf(2)
2:00.907 elemental_mastery Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleashed_fury, enhanced_unleash, mark_of_the_frostwolf(2), sudden_clarity
2:00.907 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleashed_fury, elemental_mastery, enhanced_unleash, mark_of_the_frostwolf(2), sudden_clarity
2:02.272 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleashed_fury, elemental_mastery, sudden_clarity
2:03.296 searing_totem Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, elemental_mastery, sudden_clarity
2:04.300 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, elemental_mastery, sudden_clarity
2:05.665 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, unleashed_fury, elemental_mastery, sudden_clarity
2:07.031 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, unleashed_fury, elemental_mastery, sudden_clarity
2:08.055 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury, elemental_mastery, sudden_clarity
2:09.420 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, elemental_mastery, sudden_clarity
2:10.783 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, elemental_mastery, sudden_clarity
2:12.148 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion, elemental_mastery, sudden_clarity
2:13.174 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), elemental_mastery, sudden_clarity
2:14.539 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), elemental_mastery, sudden_clarity
2:15.564 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleash_flame, unleashed_fury, elemental_mastery, enhanced_unleash, sudden_clarity
2:16.927 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion(2), unleash_flame, unleashed_fury, elemental_mastery, enhanced_unleash, sudden_clarity
2:17.951 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleashed_fury, elemental_mastery, enhanced_unleash, sudden_clarity
2:18.975 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, elemental_mastery, sudden_clarity
2:20.340 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, elemental_mastery, mark_of_the_frostwolf, sudden_clarity
2:21.704 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, mark_of_the_frostwolf
2:23.476 flame_shock Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, mark_of_the_frostwolf
2:24.806 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, mark_of_the_frostwolf
2:26.581 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge
2:27.912 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion
2:29.684 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion
2:31.014 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleash_flame, unleashed_fury, enhanced_unleash
2:32.787 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleash_flame, unleashed_fury, enhanced_unleash
2:34.560 wind_shear Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleash_flame, unleashed_fury
2:34.560 lightning_bolt Fluffy_Pillow 156992.0/160000: 98% mana elemental_fusion, unleash_flame, unleashed_fury
2:36.330 lava_burst Fluffy_Pillow 158584.3/160000: 99% mana elemental_fusion, unleash_flame, unleashed_fury
2:38.102 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury
2:39.433 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury
2:41.207 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion
2:42.537 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2)
2:44.309 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2)
2:46.082 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2)
2:47.412 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleash_flame, unleashed_fury, enhanced_unleash
2:49.186 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleash_flame, unleashed_fury, enhanced_unleash, mark_of_the_frostwolf
2:50.959 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleash_flame, unleashed_fury, mark_of_the_frostwolf
2:52.730 flame_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleashed_fury, mark_of_the_frostwolf
2:54.061 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury, mark_of_the_frostwolf
2:55.832 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury
2:57.605 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion
2:58.935 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2)
3:00.265 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana mark_of_the_frostwolf
3:02.038 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana mark_of_the_frostwolf
3:03.368 searing_totem Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury, enhanced_unleash, mark_of_the_frostwolf
3:04.372 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury, enhanced_unleash, mark_of_the_frostwolf
3:06.144 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury, mark_of_the_frostwolf
3:07.916 ascendance Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, mark_of_the_frostwolf
3:07.916 potion Fluffy_Pillow 158336.0/160000: 99% mana ascendance, unleashed_fury, mark_of_the_frostwolf
3:07.916 lava_burst Fluffy_Pillow 158336.0/160000: 99% mana ascendance, unleashed_fury, mark_of_the_frostwolf, draenic_intellect_potion
3:09.689 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana ascendance, elemental_fusion, unleashed_fury, mark_of_the_frostwolf(2), draenic_intellect_potion
3:11.463 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana ascendance, elemental_fusion(2), unleashed_fury, mark_of_the_frostwolf(2), draenic_intellect_potion
3:13.235 wind_shear Fluffy_Pillow 160000.0/160000: 100% mana ascendance, elemental_fusion(2), mark_of_the_frostwolf(2), draenic_intellect_potion
3:13.235 lava_burst Fluffy_Pillow 156992.0/160000: 98% mana ascendance, elemental_fusion(2), mark_of_the_frostwolf(2), draenic_intellect_potion
3:15.007 lava_burst Fluffy_Pillow 158986.8/160000: 99% mana ascendance, lava_surge, elemental_fusion(2), mark_of_the_frostwolf(2), draenic_intellect_potion
3:16.338 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana ascendance, elemental_fusion(2), draenic_intellect_potion
3:18.110 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana ascendance, elemental_fusion(2), draenic_intellect_potion
3:19.882 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana ascendance, elemental_fusion(2), draenic_intellect_potion
3:21.213 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana ascendance, elemental_fusion, draenic_intellect_potion
3:22.987 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion, draenic_intellect_potion
3:24.317 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), draenic_intellect_potion
3:25.648 flame_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleash_flame, unleashed_fury, enhanced_unleash, draenic_intellect_potion
3:26.980 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, enhanced_unleash, draenic_intellect_potion
3:28.754 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, unleashed_fury, draenic_intellect_potion
3:30.086 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury, draenic_intellect_potion
3:31.858 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury, draenic_intellect_potion
3:33.629 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury
3:35.401 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, mark_of_the_frostwolf
3:37.173 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, mark_of_the_frostwolf
3:38.944 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion, mark_of_the_frostwolf
3:40.276 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), mark_of_the_frostwolf
3:41.606 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleash_flame, unleashed_fury, enhanced_unleash
3:42.937 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury, enhanced_unleash
3:44.708 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury
3:46.480 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury
3:48.253 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, unleash_flame, unleashed_fury
3:49.584 wind_shear Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury
3:49.584 lightning_bolt Fluffy_Pillow 156992.0/160000: 98% mana elemental_fusion, unleashed_fury
3:51.357 lightning_bolt Fluffy_Pillow 158588.0/160000: 99% mana elemental_fusion
3:53.128 flame_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion
3:54.459 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana
3:56.231 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana
3:57.563 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury, enhanced_unleash
3:59.336 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, enhanced_unleash
4:01.109 use_item_copelands_clarity Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury
4:01.109 elemental_mastery Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury, sudden_clarity
4:01.109 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury, elemental_mastery, sudden_clarity
4:02.132 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, elemental_mastery, sudden_clarity
4:03.497 searing_totem Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, elemental_mastery, sudden_clarity
4:04.501 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, elemental_mastery, sudden_clarity
4:05.864 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, unleashed_fury, elemental_mastery, sudden_clarity
4:06.887 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, elemental_mastery, sudden_clarity
4:08.251 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, elemental_mastery, sudden_clarity
4:09.615 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion, elemental_mastery, sudden_clarity
4:10.641 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), elemental_mastery, sudden_clarity
4:12.005 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), elemental_mastery, sudden_clarity
4:13.029 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleash_flame, unleashed_fury, elemental_mastery, enhanced_unleash, sudden_clarity
4:14.392 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleash_flame, unleashed_fury, elemental_mastery, enhanced_unleash, mark_of_the_frostwolf, sudden_clarity
4:15.417 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury, elemental_mastery, enhanced_unleash, mark_of_the_frostwolf, sudden_clarity
4:16.781 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury, elemental_mastery, mark_of_the_frostwolf, sudden_clarity
4:18.145 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury, elemental_mastery, mark_of_the_frostwolf, sudden_clarity
4:19.508 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, unleashed_fury, elemental_mastery, mark_of_the_frostwolf, sudden_clarity
4:20.532 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleashed_fury, elemental_mastery, sudden_clarity
4:21.895 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleashed_fury
4:23.669 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion(2)
4:25.003 flame_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2)
4:26.334 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana lava_surge
4:28.105 wind_shear Fluffy_Pillow 160000.0/160000: 100% mana lava_surge
4:28.105 lava_burst Fluffy_Pillow 156992.0/160000: 98% mana lava_surge
4:29.435 unleash_flame Fluffy_Pillow 158449.3/160000: 99% mana elemental_fusion
4:30.766 earth_shock Fluffy_Pillow 158947.8/160000: 99% mana elemental_fusion, unleash_flame, unleashed_fury, enhanced_unleash
4:32.095 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury, enhanced_unleash
4:33.868 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury, mark_of_the_frostwolf(2)
4:35.641 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury, mark_of_the_frostwolf(2)
4:37.414 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, unleash_flame, unleashed_fury, mark_of_the_frostwolf(2)
4:38.743 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury, mark_of_the_frostwolf(2)
4:40.516 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion
4:41.846 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2)
4:43.618 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2)
4:45.390 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2)
4:46.720 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleash_flame, unleashed_fury, enhanced_unleash
4:48.493 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleash_flame, unleashed_fury, enhanced_unleash, mark_of_the_frostwolf
4:50.266 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleash_flame, unleashed_fury, mark_of_the_frostwolf
4:52.037 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleashed_fury, mark_of_the_frostwolf
4:53.368 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury
4:55.141 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion, unleashed_fury, mark_of_the_frostwolf

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 726 692 692
Agility 1483 1413 1413
Stamina 4626 4206 4206
Intellect 4182 3720 3599 (2437)
Spirit 784 784 784
Health 277560 252360 0
Mana 160000 160000 0
Spell Power 5930 4929 1209
Crit 18.58% 13.58% 944
Haste 13.06% 7.68% 768
Multistrike 42.47% 35.88% 1048
Damage / Heal Versatility 6.14% 3.14% 408
ManaReg per Second 1216 1216 0
Attack Power 1631 1413 0
Mastery 90.09% 67.59% 772
Armor 2026 2026 2026

Talents

Level
15 Nature's Guardian Stone Bulwark Totem Astral Shift
30 Frozen Power Earthgrab Totem Windwalk Totem
45 Call of the Elements Totemic Persistence Totemic Projection
60 Elemental Mastery Ancestral Swiftness Echo of the Elements
75 Rushing Streams Ancestral Guidance Conductivity
90 Unleashed Fury Primal Elementalist Elemental Blast
100 Elemental Fusion Storm Elemental Totem Liquid Magma

Profile

shaman="Shaerlyn"
origin="http://eu.battle.net/wow/en/character/forscherliga/Shaerlyn/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/96/5141344-avatar.jpg"
level=100
race=draenei
role=spell
position=back
professions=jewelcrafting=710/enchanting=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Wa!2220100
glyphs=chain_lightning/capacitor_totem/spiritwalkers_focus/lakestrider/astral_recall/ghostly_speed
spec=elemental

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_intellect_flask
actions.precombat+=/food,type=calamari_crepes
actions.precombat+=/lightning_shield,if=!buff.lightning_shield.up
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=draenic_intellect

# Executed every time the actor is available.

actions=wind_shear
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions+=/bloodlust,if=target.health.pct<25|time>0.500
actions+=/use_item,name=copelands_clarity
# In-combat potion is preferentially linked to Ascendance, unless combat will end shortly
actions+=/potion,name=draenic_intellect,if=buff.ascendance.up|target.time_to_die<=30
actions+=/berserking,if=!buff.bloodlust.up&!buff.elemental_mastery.up&(set_bonus.tier15_4pc_caster=1|(buff.ascendance.cooldown_remains=0&(dot.flame_shock.remains>buff.ascendance.duration|level<87)))
actions+=/blood_fury,if=buff.bloodlust.up|buff.ascendance.up|((cooldown.ascendance.remains>10|level<87)&cooldown.fire_elemental_totem.remains>10)
actions+=/arcane_torrent
actions+=/elemental_mastery,if=action.lava_burst.cast_time>=1.2
actions+=/ancestral_swiftness,if=!buff.ascendance.up
actions+=/storm_elemental_totem
actions+=/fire_elemental_totem,if=!active
actions+=/ascendance,if=active_enemies>1|(dot.flame_shock.remains>buff.ascendance.duration&(target.time_to_die<20|buff.bloodlust.up|time>=60)&cooldown.lava_burst.remains>0)
actions+=/liquid_magma,if=pet.searing_totem.remains>=15|pet.fire_elemental_totem.remains>=15
# If only one enemy, priority follows the 'single' action list.
actions+=/call_action_list,name=single,if=active_enemies=1
# On multiple enemies, the priority follows the 'aoe' action list.
actions+=/call_action_list,name=aoe,if=active_enemies>1

# Single target action priority list

actions.single=unleash_flame,moving=1
actions.single+=/spiritwalkers_grace,moving=1,if=buff.ascendance.up
actions.single+=/earth_shock,if=buff.lightning_shield.react=buff.lightning_shield.max_stack
actions.single+=/lava_burst,if=dot.flame_shock.remains>cast_time&(buff.ascendance.up|cooldown_react)
actions.single+=/unleash_flame,if=talent.unleashed_fury.enabled&!buff.ascendance.up
actions.single+=/flame_shock,if=dot.flame_shock.remains<=9
actions.single+=/earth_shock,if=(set_bonus.tier17_4pc&buff.lightning_shield.react>=15&!buff.lava_surge.up)|(!set_bonus.tier17_4pc&buff.lightning_shield.react>15)
actions.single+=/earthquake,if=!talent.unleashed_fury.enabled&((1+stat.spell_haste)*(1+(mastery_value*2%4.5))>=(1.875+(1.25*0.226305)+1.25*(2*0.226305*stat.multistrike_pct%100)))&target.time_to_die>10&buff.elemental_mastery.down&buff.bloodlust.down
actions.single+=/earthquake,if=!talent.unleashed_fury.enabled&((1+stat.spell_haste)*(1+(mastery_value*2%4.5))>=1.3*(1.875+(1.25*0.226305)+1.25*(2*0.226305*stat.multistrike_pct%100)))&target.time_to_die>10&(buff.elemental_mastery.up|buff.bloodlust.up)
actions.single+=/earthquake,if=!talent.unleashed_fury.enabled&((1+stat.spell_haste)*(1+(mastery_value*2%4.5))>=(1.875+(1.25*0.226305)+1.25*(2*0.226305*stat.multistrike_pct%100)))&target.time_to_die>10&(buff.elemental_mastery.remains>=10|buff.bloodlust.remains>=10)
actions.single+=/earthquake,if=talent.unleashed_fury.enabled&((1+stat.spell_haste)*(1+(mastery_value*2%4.5))>=((1.3*1.875)+(1.25*0.226305)+1.25*(2*0.226305*stat.multistrike_pct%100)))&target.time_to_die>10&buff.elemental_mastery.down&buff.bloodlust.down
actions.single+=/earthquake,if=talent.unleashed_fury.enabled&((1+stat.spell_haste)*(1+(mastery_value*2%4.5))>=1.3*((1.3*1.875)+(1.25*0.226305)+1.25*(2*0.226305*stat.multistrike_pct%100)))&target.time_to_die>10&(buff.elemental_mastery.up|buff.bloodlust.up)
actions.single+=/earthquake,if=talent.unleashed_fury.enabled&((1+stat.spell_haste)*(1+(mastery_value*2%4.5))>=((1.3*1.875)+(1.25*0.226305)+1.25*(2*0.226305*stat.multistrike_pct%100)))&target.time_to_die>10&(buff.elemental_mastery.remains>=10|buff.bloodlust.remains>=10)
actions.single+=/elemental_blast
# After the initial Ascendance, use Flame Shock pre-emptively just before Ascendance to guarantee Flame Shock staying up for the full duration of the Ascendance buff
actions.single+=/flame_shock,if=time>60&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<duration
# Keep Searing Totem up, unless Fire Elemental Totem is coming off cooldown in the next 20 seconds
actions.single+=/searing_totem,if=(!talent.liquid_magma.enabled&!totem.fire.active)|(talent.liquid_magma.enabled&pet.searing_totem.remains<=20&!pet.fire_elemental_totem.active&!buff.liquid_magma.up)
actions.single+=/spiritwalkers_grace,moving=1,if=((talent.elemental_blast.enabled&cooldown.elemental_blast.remains=0)|(cooldown.lava_burst.remains=0&!buff.lava_surge.react))
actions.single+=/lightning_bolt

# Multi target action priority list

actions.aoe=earthquake,cycle_targets=1,if=!ticking&(buff.enhanced_chain_lightning.up|level<=90)&active_enemies>=2
actions.aoe+=/lava_beam
actions.aoe+=/earth_shock,if=buff.lightning_shield.react=buff.lightning_shield.max_stack
actions.aoe+=/thunderstorm,if=active_enemies>=10
actions.aoe+=/searing_totem,if=(!talent.liquid_magma.enabled&!totem.fire.active)|(talent.liquid_magma.enabled&pet.searing_totem.remains<=20&!pet.fire_elemental_totem.active&!buff.liquid_magma.up)
actions.aoe+=/chain_lightning,if=active_enemies>=2
actions.aoe+=/lightning_bolt

head=hood_of_dispassionate_execution,id=113608,bonus_id=566
neck=primal_gladiators_pendant_of_cruelty,id=115655,enchant=75mult
shoulders=primal_gladiators_ringmail_spaulders,id=115724
back=cloak_of_searing_shadows,id=113847,bonus_id=564/566,gems=50mult,enchant=gift_of_multistrike
chest=undying_chestguard,id=114498,bonus_id=53
shirt=wraps_of_the_bloodsoaked_brawler,id=98543
wrists=bracers_of_the_crying_chorus,id=113826,bonus_id=564/566,gems=50mult
hands=chainhoof_grips,id=115427
waist=belt_of_imminent_lies,id=113827,bonus_id=566
legs=exceptional_crystalleaf_legguards,id=116929
feet=treads_of_sand_and_blood,id=113595,bonus_id=564/566,gems=50mult
finger1=timeless_solium_band_of_the_archmage,id=118296,enchant=50mult
finger2=whispering_taladite_ring,id=115798,bonus_id=76/527/540,enchant=50mult
trinket1=quiescent_runestone,id=113859
trinket2=copelands_clarity,id=118878
main_hand=butchers_terrible_tenderizer,id=113607,enchant=mark_of_the_frostwolf
off_hand=maw_of_souls,id=113653,bonus_id=564/566,gems=50mult

# Gear Summary
# gear_stamina=3316
# gear_intellect=2437
# gear_spell_power=1209
# gear_crit_rating=944
# gear_haste_rating=768
# gear_mastery_rating=772
# gear_armor=2026
# gear_multistrike_rating=998
# gear_versatility_rating=408

Candylicious

Candylicious : 24995 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
24994.6 24994.6 7.9 / 0.032% 2455.9 / 9.8% 1.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
14233.8 14233.8 Mana 3.01% 42.8 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Candylicious/advanced
Talents
  • 15: Soul Leech
  • 30: Shadowfury
  • 45: Soul Link
  • 60: Blood Horror
  • 75: Grimoire of Supremacy
  • 90: Kil'jaeden's Cunning
  • 100: Demonic Servitude
  • Talent Calculator
Glyphs
  • Glyph of Siphon Life
  • Glyph of Havoc
  • Glyph of Demon Training
  • Glyph of Nightmares
  • Glyph of Verdant Spheres
Professions
  • inscription: 189
  • tailoring: 700

Charts

http://4.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Candylicious+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x150&chd=t:35275|33677|23296|11667&chds=0,70550&chco=C41F3B,9482C9,C41F3B,C41F3B&chm=t++35275++immolate,C41F3B,0,0,15|t++33677++chaos_bolt,9482C9,1,0,15|t++23296++conflagrate,C41F3B,2,0,15|t++11667++incinerate,C41F3B,3,0,15& http://5.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Candylicious+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:40,38,32,17,11&chds=0,100&chdls=ffffff&chco=C41F3B,9482C9,9482C9,C41F3B,C41F3B&chl=incinerate|terrorguard: doom_bolt|chaos_bolt|immolate|conflagrate&
http://7.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Candylicious+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:Vceossvwz376566876543yyomnnnnkggfgfedcbdddcdbcbbbbcccbbbbcdbdcbdeddcbcbbccbddcddbcdbbcacecdcbddbccbbdcdcbccccdbccbccggljlnnpqqrrrqstuttuprmmjjggedddcdcZabZZYWYYYZYXZZYZZYYYZZZYZaZaaZbbbdcbbbbdcbccdefcddcdcbddeefeeeffeedffgfgffffdgffffcgggkkmmpqsusttruuuwxuwurrommkhhhgihfffdfdbccaeeddeceecdedfeeefffgfgfghhhhggggggfhhghhfggefgehhhhhghigiigijijkijjijihjjiiighighgeedbaYVUTRPO&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.55751,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=24995|max=44832&chxp=1,1,56,100 http://0.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Candylicious+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,0,1,0,0,3,6,26,44,56,114,136,204,356,446,594,754,882,1055,1138,1293,1455,1504,1512,1579,1481,1421,1423,1268,1183,984,888,742,618,478,403,272,210,139,124,83,52,30,16,9,4,8,3,0,2&chds=0,1579&chbh=5&chxt=x&chxl=0:|min=22479|avg=24995|max=27566&chxp=0,1,49,100& http://6.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Candylicious+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:62.4,17.0,8.8,8.6,3.0&chds=0,100&chdls=ffffff&chco=C41F3B,9482C9,C41F3B,C41F3B,ffffff&chl=incinerate 187.9s|chaos_bolt 51.1s|conflagrate 26.5s|immolate 25.7s|waiting 9.1s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Candylicious 24995
chaos_bolt 5732 22.9% 24.8 12.02sec 69479 33677 Direct 24.6 0 62584 62584 100.0% 9.8 0 18769 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.76 24.56 0.00 0.00 2.0631 0.0000 1720532.55 1720532.55 0.00 33677.16 33677.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 9.76 100.00% 18768.63 16089 24642 18791.24 0 24642 183174 183174 0.00
crit 24.56 100.00% 62584.48 53629 82140 62666.96 59664 66555 1537359 1537359 0.00
 
DPS Timeline Chart
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:shadow
  • resource:burning_ember
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.havoc.remains>cast_time&buff.havoc.stack>=3
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:shadow
  • tooltip:Deals Shadow damage every $t2 sec.
  • description:Unleashes a blast of chaos, causing ${$m1*(1+$77220m1/100*$<masteryMod>)} Shadow damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.{$?s116858=true}[][ Replaces Soul Fire.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.107500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
conflagrate 2055 8.2% 26.4 11.57sec 23400 23296 Direct 26.4 16171 33108 20917 28.0% 10.4 4851 9929 27.9%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.37 26.37 0.00 0.00 1.0045 0.0000 617129.55 617129.55 0.00 23295.82 23295.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.92 27.92% 9929.00 9417 11213 9437.81 0 11213 28953 28953 0.00
multistrike 7.53 72.08% 4851.40 4708 5606 4851.60 0 5606 36525 36525 0.00
hit 18.98 71.98% 16171.19 15694 18688 16176.35 15694 17076 306980 306980 0.00
crit 7.39 28.02% 33107.78 31389 37376 33152.85 0 37376 244671 244671 0.00
 
DPS Timeline Chart
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:6400.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=2
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Target enemy instantly explodes, dealing {$s1=2778} Fire damage{$?s56235=false}[, reducing movement speed by {$s2=50}% for {$d=5 seconds},][] and generating Burning Embers.{$?s56235=false}[][ Targets afflicted by Immolate will have {$s2=50}% reduced movement speed for {$d=5 seconds}.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.890000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
immolate 3022 12.1% 20.6 14.90sec 44064 35275 Direct 20.6 7822 15990 9975 26.4% 8.2 2347 4800 26.2%  
Periodic 122.4 3891 7916 4951 26.3% 48.5 1170 2380 26.3% 99.3%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.61 20.61 122.40 122.40 1.2492 2.4413 908011.38 908011.38 0.00 2797.72 35274.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.13 26.16% 4800.07 4567 5438 4269.58 0 5438 10235 10235 0.00
multistrike 6.02 73.84% 2346.58 2284 2719 2344.06 0 2719 14124 14124 0.00
hit 15.17 73.63% 7821.57 7612 9063 7824.02 7612 8257 118680 118680 0.00
crit 5.43 26.37% 15990.19 15224 18127 15982.32 0 18127 86881 86881 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 12.8 26.35% 2380.49 2283 2719 2381.90 2283 2719 30386 30386 0.00
multistrike 35.7 73.65% 1169.65 1142 1359 1170.12 1142 1238 41741 41741 0.00
hit 90.2 73.68% 3891.33 33 4531 3892.88 3760 3979 350936 350936 0.00
crit 32.2 26.32% 7916.39 66 9062 7921.73 7344 8409 255029 255029 0.00
 
DPS Timeline Chart
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy for {$s1=675} Fire damage and an additional $157736o1 Fire damage over {$157736d=15 seconds}.{$?s108647=false}[ Immolate critical strikes generate Burning Embers.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.989820
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.494910
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
incinerate 7293 29.2% 138.9 2.16sec 15782 11667 Direct 138.0 11303 22986 14198 24.8% 54.7 3391 6895 24.8%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 138.90 137.98 0.00 0.00 1.3528 0.0000 2192078.61 2192078.61 0.00 11666.57 11666.57
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 13.58 24.83% 6895.32 6619 7881 6898.82 6619 7881 93645 93645 0.00
multistrike 41.11 75.17% 3390.51 3309 3940 3391.51 3309 3576 139370 139370 0.00
hit 103.80 75.22% 11303.44 11031 13135 11306.63 11095 11544 1173266 1173266 0.00
crit 34.19 24.78% 22986.32 22062 26269 23000.28 22162 24276 785797 785797 0.00
 
DPS Timeline Chart
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:32000.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Deals {$s1=1954} Fire damage to an enemy{$?s108647=false}[ and generates Burning Embers][].
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.328250
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - terrorguard 6893 / 6893
doom_bolt 6893 27.6% 106.8 2.81sec 19389 7954 Direct 106.1 13668 27774 17434 26.7% 42.1 4100 8334 26.7%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 106.80 106.15 0.00 0.00 2.4376 0.0000 2070776.40 2070776.40 0.00 7954.09 7954.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 11.23 26.68% 8334.48 7681 10975 8340.69 7681 10975 93619 93619 0.00
multistrike 30.87 73.32% 4100.19 3841 5488 4101.01 3841 4553 126586 126586 0.00
hit 77.80 73.30% 13668.16 12802 18292 13670.73 13170 14184 1063448 1063448 0.00
crit 28.34 26.70% 27773.51 25603 36583 27795.58 25848 30606 787123 787123 0.00
 
DPS Timeline Chart
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=2382} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.{$?s152107=false}[ Master gains {$s3=6} Demonic Fury. |cFF777777(Right-Click to toggle)|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.620000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
Candylicious
dark_soul 3.0 120.79sec

Stats details: dark_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.37 78.69% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.64 21.31% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: dark_soul

Static Values
  • id:113858
  • school:fire
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:8000.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.archimondes_darkness.enabled|(talent.archimondes_darkness.enabled&(charges=2|trinket.proc.intellect.react|trinket.stacking_proc.intellect.react>6|target.health.pct<=10))
Spelldata
  • id:113858
  • name:Dark Soul: Instability
  • school:fire
  • tooltip:Critical strike chance increased by $w1%.
  • description:Infuses your soul with unstable power, increasing your critical strike chance by {$113858s1=30}% for {$113858d=20 seconds}.{$?s56228=false}[ |cFFFFFFFFPassive:|r Increases your critical strike chance by ${$113858m1/$56228m1}%. This effect is disabled while on cooldown.][]
 
draenic_intellect_potion 2.0 0.00sec

Stats details: draenic_intellect_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156426
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156426
  • name:Draenic Intellect Potion
  • school:physical
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
 
summon_terrorguard 1.0 0.00sec

Stats details: summon_terrorguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.64 81.76% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.36 18.24% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: summon_terrorguard

Static Values
  • id:112927
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:20000.0
  • cooldown:600.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.demonic_servitude.enabled&active_enemies<5
Spelldata
  • id:112927
  • name:Summon Terrorguard
  • school:shadow
  • tooltip:
  • description:Summons a Terrorguard for {$112926d=60 seconds} to assault the target with its Doom Bolts.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
backdraft 24.7 1.7 12.4sec 11.6sec 50.02% 50.03% 0.0(0.0)

Buff details

  • buff initial source:Candylicious
  • cooldown name:buff_backdraft
  • max_stacks:6
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • backdraft_1:12.62%
  • backdraft_2:16.57%
  • backdraft_3:18.95%
  • backdraft_4:0.81%
  • backdraft_5:0.43%
  • backdraft_6:0.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate's cast time and mana cost reduced by {$s1=30}%.$?$W3<>0[ Chaos Bolt's cast time reduced by {$s3=30}%][]
  • description:{$@spelldesc117896=When you cast Conflagrate, the cast time and mana cost of your next Chaos Bolt or next three Incinerates is reduced by {$117828s1=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 25.94% 0.0(0.0)

Buff details

  • buff initial source:Candylicious
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
dark_soul (dark_soul) 3.0 0.0 121.0sec 120.8sec 19.27% 23.56% 0.0(0.0)

Buff details

  • buff initial source:Candylicious
  • cooldown name:buff_dark_soul
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • dark_soul_1:19.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:113858
  • name:Dark Soul: Instability
  • tooltip:Critical strike chance increased by $w1%.
  • description:Infuses your soul with unstable power, increasing your critical strike chance by {$113858s1=30}% for {$113858d=20 seconds}.{$?s56228=false}[ |cFFFFFFFFPassive:|r Increases your critical strike chance by ${$113858m1/$56228m1}%. This effect is disabled while on cooldown.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
draenic_intellect_potion 2.0 0.0 240.0sec 0.0sec 15.21% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Candylicious
  • cooldown name:buff_draenic_intellect_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:1000.00

Stack Uptimes

  • draenic_intellect_potion_1:15.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156426
  • name:Draenic Intellect Potion
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
mark_of_the_thunderlord 9.8 5.1 31.8sec 20.3sec 43.00% 43.01% 5.1(5.1)

Buff details

  • buff initial source:Candylicious
  • cooldown name:buff_mark_of_the_thunderlord
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:crit_rating
  • amount:500.00

Stack Uptimes

  • mark_of_the_thunderlord_1:43.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:159234
  • name:Mark of the Thunderlord
  • tooltip:Critical Strike increased by $w1.
  • description:Critical Strike increased by {$s1=500}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_intellect_flask

Buff details

  • buff initial source:Candylicious
  • cooldown name:buff_greater_draenic_intellect_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:250.00

Stack Uptimes

  • greater_draenic_intellect_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156079
  • name:Greater Draenic Intellect Flask
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Candylicious
chaos_bolt Burning Ember 24.8 24.8 1.0 1.0 69479.3
conflagrate Mana 26.4 168788.9 6400.0 6400.0 3.7
dark_soul Mana 3.0 24055.7 8000.0 8000.0 0.0
immolate Mana 20.6 395651.0 19200.0 19200.1 2.3
incinerate Mana 138.9 3694975.3 26602.1 26602.2 0.6
pet - terrorguard
doom_bolt Energy 106.8 3738.1 35.0 35.0 554.0
Resource Gains Type Count Total Average Overflow
incinerate Burning Ember 138.90 17.33 (70.82%) 0.12 0.00 0.00%
immolate Burning Ember 37.65 3.76 (15.38%) 0.10 0.00 0.00%
conflagrate Burning Ember 26.37 3.38 (13.80%) 0.13 0.00 0.00%
external_healing Health 8.19 0.00 (0.00%) 0.00 77152.35 100.00%
mp5_regen Mana 302.87 4218604.38 (100.00%) 13928.59 55654.51 1.30%
soul_leech Health 137.98 0.00 (0.00%) 0.00 293860.83 100.00%
siphon_life Health 122.40 0.00 (0.00%) 0.00 1303442.77 100.00%
pet - terrorguard
energy_regen Energy 501.66 3673.28 (100.00%) 7.32 3.99 0.11%
Resource RPS-Gain RPS-Loss
Mana 14018.32 14233.83
Burning Ember 0.08 0.08
Combat End Resource Mean Min Max
Mana 103217.17 28611.17 163572.39
Burning Ember 0.60 0.00 1.50
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.1%
felhunter-Mana Cap 1.1%
imp-Mana Cap 1.1%
succubus-Mana Cap 1.1%
voidwalker-Mana Cap 1.1%
infernal-Mana Cap 1.1%
doomguard-Mana Cap 1.1%
observer-Mana Cap 1.1%
fel_imp-Mana Cap 1.1%
shivarra-Mana Cap 1.1%
voidlord-Mana Cap 1.1%
abyssal-Mana Cap 1.1%
terrorguard-Mana Cap 1.1%
service_felhunter-Mana Cap 1.1%
service_imp-Mana Cap 1.1%
service_succubus-Mana Cap 1.1%
service_voidwalker-Mana Cap 1.1%

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Candylicious Fight Length
Count 25000
Mean 300.94
Minimum 230.43
Maximum 374.11
Spread ( max - min ) 143.68
Range [ ( max - min ) / 2 * 100% ] 23.87%
DPS
Sample Data Candylicious Damage Per Second
Count 25000
Mean 24994.56
Minimum 22478.62
Maximum 27565.80
Spread ( max - min ) 5087.19
Range [ ( max - min ) / 2 * 100% ] 10.18%
Standard Deviation 636.4049
5th Percentile 23975.84
95th Percentile 26066.74
( 95th Percentile - 5th Percentile ) 2090.90
Mean Distribution
Standard Deviation 4.0250
95.00% Confidence Intervall ( 24986.67 - 25002.45 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2490
0.1 Scale Factor Error with Delta=300 3457
0.05 Scale Factor Error with Delta=300 13829
0.01 Scale Factor Error with Delta=300 345740
Distribution Chart
DPS(e)
Sample Data Candylicious Damage Per Second (Effective)
Count 25000
Mean 24994.56
Minimum 22478.62
Maximum 27565.80
Spread ( max - min ) 5087.19
Range [ ( max - min ) / 2 * 100% ] 10.18%
Damage
Sample Data Candylicious Damage
Count 25000
Mean 5437752.09
Minimum 3991646.22
Maximum 7034596.89
Spread ( max - min ) 3042950.66
Range [ ( max - min ) / 2 * 100% ] 27.98%
DTPS
Sample Data Candylicious Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Candylicious Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Candylicious Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Candylicious Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Candylicious Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Candylicious Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data CandyliciousTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Candylicious Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_intellect_flask
1 0.00 food,type=blackrock_barbecue
2 0.00 dark_intent,if=!aura.spell_power_multiplier.up
3 0.00 summon_pet,if=!talent.demonic_servitude.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.grimoire_of_sacrifice.down)
4 0.00 summon_doomguard,if=talent.demonic_servitude.enabled&active_enemies<5
5 0.00 summon_infernal,if=talent.demonic_servitude.enabled&active_enemies>=5
6 0.00 snapshot_stats
7 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled&!talent.demonic_servitude.enabled
8 0.00 service_pet,if=talent.grimoire_of_service.enabled
9 0.00 potion,name=draenic_intellect
A 0.00 incinerate
Default action list Executed every time the actor is available.
# count action,conditions
B 1.00 potion,name=draenic_intellect,if=buff.bloodlust.react|target.health.pct<=20
C 0.00 berserking
D 0.00 blood_fury
E 0.00 arcane_torrent
F 0.00 mannoroths_fury
G 3.01 dark_soul,if=!talent.archimondes_darkness.enabled|(talent.archimondes_darkness.enabled&(charges=2|trinket.proc.intellect.react|trinket.stacking_proc.intellect.react>6|target.health.pct<=10))
H 0.00 service_pet,if=talent.grimoire_of_service.enabled
I 0.00 summon_doomguard,if=!talent.demonic_servitude.enabled&active_enemies<5
J 0.00 summon_infernal,if=!talent.demonic_servitude.enabled&active_enemies>=5
K 0.00 run_action_list,name=single_target,if=active_enemies<6
L 0.00 run_action_list,name=aoe,if=active_enemies>=6
actions.single_target
# count action,conditions
M 0.00 havoc,target=2
N 0.00 shadowburn,if=talent.charred_remains.enabled&(burning_ember>=2.5|buff.dark_soul.up|target.time_to_die<10)
O 0.00 cataclysm,if=active_enemies>1
P 0.00 fire_and_brimstone,if=buff.fire_and_brimstone.down&dot.immolate.remains<=action.immolate.cast_time&(cooldown.cataclysm.remains>action.immolate.cast_time|!talent.cataclysm.enabled)&active_enemies>4
Q 1.49 immolate,cycle_targets=1,if=remains<=cast_time&(cooldown.cataclysm.remains>cast_time|!talent.cataclysm.enabled)
R 0.00 cancel_buff,name=fire_and_brimstone,if=buff.fire_and_brimstone.up&dot.immolate.remains>(dot.immolate.duration*0.3)
S 0.00 shadowburn,if=buff.havoc.remains
T 0.00 chaos_bolt,if=buff.havoc.remains>cast_time&buff.havoc.stack>=3
U 1.00 conflagrate,if=charges=2
V 0.00 cataclysm
W 0.00 rain_of_fire,if=remains<=tick_time&(active_enemies>4|(buff.mannoroths_fury.up&active_enemies>2))
X 0.00 chaos_bolt,if=talent.charred_remains.enabled&active_enemies>1&target.health.pct>20
Y 0.00 chaos_bolt,if=talent.charred_remains.enabled&buff.backdraft.stack<3&burning_ember>=2.5
Z 24.93 chaos_bolt,if=buff.backdraft.stack<3&(burning_ember>=3.5|buff.dark_soul.up|(burning_ember>=3&buff.ember_master.react)|target.time_to_die<20)
a 0.00 chaos_bolt,if=buff.backdraft.stack<3&set_bonus.tier17_2pc=1&burning_ember>=2.5
b 0.00 chaos_bolt,if=buff.backdraft.stack<3&buff.archmages_greater_incandescence_int.react&buff.archmages_greater_incandescence_int.remains>cast_time
c 0.00 chaos_bolt,if=buff.backdraft.stack<3&trinket.proc.intellect.react&trinket.proc.intellect.remains>cast_time
d 0.00 chaos_bolt,if=buff.backdraft.stack<3&trinket.stacking_proc.intellect.react>7&trinket.stacking_proc.intellect.remains>=cast_time
e 0.00 chaos_bolt,if=buff.backdraft.stack<3&trinket.proc.crit.react&trinket.proc.crit.remains>cast_time
f 0.00 chaos_bolt,if=buff.backdraft.stack<3&trinket.stacking_proc.multistrike.react>=8&trinket.stacking_proc.multistrike.remains>=cast_time
g 0.00 chaos_bolt,if=buff.backdraft.stack<3&trinket.proc.multistrike.react&trinket.proc.multistrike.remains>cast_time
h 0.00 chaos_bolt,if=buff.backdraft.stack<3&trinket.proc.versatility.react&trinket.proc.versatility.remains>cast_time
i 0.00 chaos_bolt,if=buff.backdraft.stack<3&trinket.proc.mastery.react&trinket.proc.mastery.remains>cast_time
j 0.00 fire_and_brimstone,if=buff.fire_and_brimstone.down&dot.immolate.remains<=(dot.immolate.duration*0.3)&active_enemies>4
k 19.21 immolate,cycle_targets=1,if=remains<=(duration*0.3)
l 25.37 conflagrate
m 138.55 incinerate

Sample Sequence

0149AGQUlmmmmZmZmklmmmZmmmmmlkmmmmmmmmlmmmmkmmmZlmmmmkmlmmZmmmkmlmmmZmmlkmmmmmZlmmkmmmmlmZmmkmmGZZZlmmZklmmmZmmmlkmmmmmmmlmmkmmmmlmmmmkmmZlmmmmmklmZmmmmmlkmmZmmmlmmkmZmmlmmmmZBkmGZZlmZmklmmmZmmmmlkmmmmmZlmZkmmmmmlmZm

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 168000.0/168000: 100% mana | 1.0/4: 25% burning_ember
Pre food Fluffy_Pillow 168000.0/168000: 100% mana | 1.0/4: 25% burning_ember
Pre summon_terrorguard Fluffy_Pillow 168000.0/168000: 100% mana | 1.0/4: 25% burning_ember
Pre potion Fluffy_Pillow 168000.0/168000: 100% mana | 1.0/4: 25% burning_ember draenic_intellect_potion
0:00.000 incinerate Fluffy_Pillow 136000.0/168000: 81% mana | 1.1/4: 28% burning_ember mark_of_the_thunderlord, draenic_intellect_potion
0:00.000 dark_soul Fluffy_Pillow 136000.0/168000: 81% mana | 1.0/4: 25% burning_ember mark_of_the_thunderlord, draenic_intellect_potion
0:00.000 immolate Fluffy_Pillow 128000.0/168000: 76% mana | 1.0/4: 25% burning_ember dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
0:01.275 conflagrate Fluffy_Pillow 131486.2/168000: 78% mana | 1.1/4: 28% burning_ember bloodlust, dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
0:02.279 conflagrate Fluffy_Pillow 142950.4/168000: 85% mana | 1.2/4: 30% burning_ember bloodlust, backdraft(3), dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
0:03.284 incinerate Fluffy_Pillow 154432.5/168000: 92% mana | 1.4/4: 35% burning_ember bloodlust, backdraft(6), dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
0:04.290 incinerate Fluffy_Pillow 149932.3/168000: 89% mana | 1.6/4: 40% burning_ember bloodlust, backdraft(5), dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
0:05.294 incinerate Fluffy_Pillow 145396.6/168000: 87% mana | 1.7/4: 43% burning_ember bloodlust, backdraft(4), dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
0:06.299 incinerate Fluffy_Pillow 140878.6/168000: 84% mana | 1.8/4: 45% burning_ember bloodlust, backdraft(3), dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
0:07.305 chaos_bolt Fluffy_Pillow 136378.4/168000: 81% mana | 1.9/4: 48% burning_ember bloodlust, backdraft(2), dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
0:08.938 incinerate Fluffy_Pillow 165434.5/168000: 98% mana | 0.9/4: 23% burning_ember bloodlust, backdraft(2), dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
0:09.942 chaos_bolt Fluffy_Pillow 160898.8/168000: 96% mana | 1.1/4: 28% burning_ember bloodlust, backdraft, dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
0:11.575 incinerate Fluffy_Pillow 168000.0/168000: 100% mana | 0.1/4: 3% burning_ember bloodlust, backdraft, dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
0:12.580 immolate Fluffy_Pillow 163482.0/168000: 97% mana | 0.2/4: 5% burning_ember bloodlust, dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
0:13.584 conflagrate Fluffy_Pillow 162146.3/168000: 97% mana | 0.3/4: 8% burning_ember bloodlust, dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
0:14.589 incinerate Fluffy_Pillow 168000.0/168000: 100% mana | 0.5/4: 13% burning_ember bloodlust, backdraft(3), dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
0:15.592 incinerate Fluffy_Pillow 163446.5/168000: 97% mana | 0.8/4: 20% burning_ember bloodlust, backdraft(2), dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
0:16.597 incinerate Fluffy_Pillow 158928.5/168000: 95% mana | 0.9/4: 23% burning_ember bloodlust, backdraft, dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
0:17.601 chaos_bolt Fluffy_Pillow 154392.7/168000: 92% mana | 1.2/4: 30% burning_ember bloodlust, dark_soul, draenic_intellect_potion
0:19.235 incinerate Fluffy_Pillow 168000.0/168000: 100% mana | 0.2/4: 5% burning_ember bloodlust, dark_soul, draenic_intellect_potion
0:20.543 incinerate Fluffy_Pillow 145661.6/168000: 87% mana | 0.4/4: 10% burning_ember bloodlust
0:21.850 incinerate Fluffy_Pillow 136917.2/168000: 81% mana | 0.6/4: 15% burning_ember bloodlust
0:23.159 incinerate Fluffy_Pillow 128208.3/168000: 76% mana | 0.7/4: 18% burning_ember bloodlust
0:24.469 incinerate Fluffy_Pillow 119517.3/168000: 71% mana | 0.9/4: 23% burning_ember bloodlust
0:25.775 conflagrate Fluffy_Pillow 110755.0/168000: 66% mana | 1.0/4: 25% burning_ember bloodlust
0:26.779 immolate Fluffy_Pillow 122219.3/168000: 73% mana | 1.1/4: 28% burning_ember bloodlust, backdraft(3)
0:27.783 incinerate Fluffy_Pillow 120883.5/168000: 72% mana | 1.1/4: 28% burning_ember bloodlust, backdraft(3)
0:28.788 incinerate Fluffy_Pillow 116365.6/168000: 69% mana | 1.3/4: 33% burning_ember bloodlust, backdraft(2)
0:29.792 incinerate Fluffy_Pillow 111829.8/168000: 67% mana | 1.4/4: 35% burning_ember bloodlust, backdraft
0:30.797 incinerate Fluffy_Pillow 107311.9/168000: 64% mana | 1.6/4: 40% burning_ember bloodlust
0:32.105 incinerate Fluffy_Pillow 98585.2/168000: 59% mana | 1.7/4: 43% burning_ember bloodlust
0:33.410 incinerate Fluffy_Pillow 89805.2/168000: 53% mana | 1.8/4: 45% burning_ember bloodlust
0:34.719 incinerate Fluffy_Pillow 81096.3/168000: 48% mana | 1.9/4: 48% burning_ember bloodlust
0:36.027 incinerate Fluffy_Pillow 72369.7/168000: 43% mana | 2.0/4: 50% burning_ember bloodlust
0:37.334 conflagrate Fluffy_Pillow 63625.2/168000: 38% mana | 2.1/4: 53% burning_ember bloodlust
0:38.340 incinerate Fluffy_Pillow 75125.0/168000: 45% mana | 2.3/4: 58% burning_ember bloodlust, backdraft(3)
0:39.344 incinerate Fluffy_Pillow 70589.3/168000: 42% mana | 2.5/4: 63% burning_ember bloodlust, backdraft(2)
0:40.349 incinerate Fluffy_Pillow 66071.3/168000: 39% mana | 2.6/4: 65% burning_ember bloodlust, backdraft
0:41.354 incinerate Fluffy_Pillow 57426.8/168000: 34% mana | 2.7/4: 68% burning_ember
0:43.054 immolate Fluffy_Pillow 48694.6/168000: 29% mana | 3.0/4: 75% burning_ember
0:44.331 incinerate Fluffy_Pillow 46972.9/168000: 28% mana | 3.0/4: 75% burning_ember
0:46.032 incinerate Fluffy_Pillow 38254.5/168000: 23% mana | 3.3/4: 83% burning_ember
0:47.731 Waiting 0.200 sec 29508.6/168000: 18% mana | 3.4/4: 85% burning_ember
0:47.931 incinerate Fluffy_Pillow 32246.0/168000: 19% mana | 3.4/4: 85% burning_ember
0:49.628 chaos_bolt Fluffy_Pillow 23472.8/168000: 14% mana | 3.5/4: 88% burning_ember mark_of_the_thunderlord
0:51.752 conflagrate Fluffy_Pillow 52544.0/168000: 31% mana | 2.5/4: 63% burning_ember mark_of_the_thunderlord
0:52.757 incinerate Fluffy_Pillow 59899.4/168000: 36% mana | 2.6/4: 65% burning_ember backdraft(3), mark_of_the_thunderlord
0:53.946 incinerate Fluffy_Pillow 53773.2/168000: 32% mana | 2.7/4: 68% burning_ember backdraft(2), mark_of_the_thunderlord
0:55.136 incinerate Fluffy_Pillow 47660.7/168000: 28% mana | 2.8/4: 70% burning_ember backdraft, mark_of_the_thunderlord
0:56.325 incinerate Fluffy_Pillow 41534.6/168000: 25% mana | 3.0/4: 75% burning_ember mark_of_the_thunderlord
0:58.025 immolate Fluffy_Pillow 32802.4/168000: 20% mana | 3.1/4: 78% burning_ember mark_of_the_thunderlord
0:59.300 Waiting 0.100 sec 31053.3/168000: 18% mana | 3.1/4: 78% burning_ember mark_of_the_thunderlord
0:59.400 incinerate Fluffy_Pillow 32422.0/168000: 19% mana | 3.1/4: 78% burning_ember mark_of_the_thunderlord
1:01.100 Waiting 0.200 sec 23689.9/168000: 14% mana | 3.2/4: 80% burning_ember mark_of_the_thunderlord
1:01.300 conflagrate Fluffy_Pillow 26427.3/168000: 16% mana | 3.2/4: 80% burning_ember mark_of_the_thunderlord
1:02.307 incinerate Fluffy_Pillow 33810.1/168000: 20% mana | 3.3/4: 83% burning_ember backdraft(3), mark_of_the_thunderlord
1:03.498 incinerate Fluffy_Pillow 27711.3/168000: 16% mana | 3.4/4: 85% burning_ember backdraft(2), mark_of_the_thunderlord
1:04.689 chaos_bolt Fluffy_Pillow 21612.5/168000: 13% mana | 3.6/4: 90% burning_ember backdraft
1:06.809 incinerate Fluffy_Pillow 50628.9/168000: 30% mana | 2.6/4: 65% burning_ember backdraft
1:08.000 incinerate Fluffy_Pillow 44530.1/168000: 27% mana | 2.7/4: 68% burning_ember
1:09.699 incinerate Fluffy_Pillow 35784.3/168000: 21% mana | 2.8/4: 70% burning_ember
1:11.399 Waiting 0.400 sec 27052.1/168000: 16% mana | 2.9/4: 73% burning_ember
1:11.799 immolate Fluffy_Pillow 32526.9/168000: 19% mana | 2.9/4: 73% burning_ember
1:13.075 Waiting 0.100 sec 30791.5/168000: 18% mana | 2.9/4: 73% burning_ember
1:13.175 incinerate Fluffy_Pillow 32160.2/168000: 19% mana | 2.9/4: 73% burning_ember
1:14.876 conflagrate Fluffy_Pillow 23441.8/168000: 14% mana | 3.0/4: 75% burning_ember
1:15.881 incinerate Fluffy_Pillow 30797.2/168000: 18% mana | 3.1/4: 78% burning_ember backdraft(3)
1:17.070 incinerate Fluffy_Pillow 24671.0/168000: 15% mana | 3.2/4: 80% burning_ember backdraft(2)
1:18.259 Waiting 0.300 sec 18544.8/168000: 11% mana | 3.3/4: 83% burning_ember backdraft
1:18.559 incinerate Fluffy_Pillow 22650.9/168000: 13% mana | 3.3/4: 83% burning_ember backdraft
1:19.751 Waiting 0.800 sec 16565.8/168000: 10% mana | 3.4/4: 85% burning_ember
1:20.551 chaos_bolt Fluffy_Pillow 27515.4/168000: 16% mana | 3.5/4: 88% burning_ember
1:22.675 incinerate Fluffy_Pillow 56586.6/168000: 34% mana | 2.5/4: 63% burning_ember
1:24.376 incinerate Fluffy_Pillow 47868.1/168000: 28% mana | 2.6/4: 65% burning_ember
1:26.076 conflagrate Fluffy_Pillow 39136.0/168000: 23% mana | 2.8/4: 70% burning_ember
1:27.081 immolate Fluffy_Pillow 46491.4/168000: 28% mana | 2.9/4: 73% burning_ember backdraft(3)
1:28.356 incinerate Fluffy_Pillow 44742.3/168000: 27% mana | 2.9/4: 73% burning_ember backdraft(3)
1:29.548 incinerate Fluffy_Pillow 38657.2/168000: 23% mana | 3.1/4: 78% burning_ember backdraft(2)
1:30.738 incinerate Fluffy_Pillow 32544.7/168000: 19% mana | 3.2/4: 80% burning_ember backdraft
1:31.930 Waiting 0.500 sec 26459.6/168000: 16% mana | 3.3/4: 83% burning_ember
1:32.430 incinerate Fluffy_Pillow 33303.1/168000: 20% mana | 3.3/4: 83% burning_ember
1:34.129 Waiting 0.600 sec 24557.3/168000: 15% mana | 3.4/4: 85% burning_ember
1:34.729 incinerate Fluffy_Pillow 32769.5/168000: 20% mana | 3.4/4: 85% burning_ember
1:36.429 chaos_bolt Fluffy_Pillow 24037.3/168000: 14% mana | 3.5/4: 88% burning_ember mark_of_the_thunderlord
1:38.552 conflagrate Fluffy_Pillow 53094.8/168000: 32% mana | 2.5/4: 63% burning_ember mark_of_the_thunderlord
1:39.557 incinerate Fluffy_Pillow 60450.2/168000: 36% mana | 2.6/4: 65% burning_ember backdraft(3), mark_of_the_thunderlord
1:40.748 incinerate Fluffy_Pillow 54351.4/168000: 32% mana | 2.7/4: 68% burning_ember backdraft(2), mark_of_the_thunderlord
1:41.940 immolate Fluffy_Pillow 48266.3/168000: 29% mana | 2.8/4: 70% burning_ember backdraft, mark_of_the_thunderlord
1:43.216 incinerate Fluffy_Pillow 46530.9/168000: 28% mana | 2.8/4: 70% burning_ember backdraft, mark_of_the_thunderlord
1:44.406 incinerate Fluffy_Pillow 40418.4/168000: 24% mana | 3.0/4: 75% burning_ember mark_of_the_thunderlord
1:46.105 Waiting 0.100 sec 31672.6/168000: 19% mana | 3.1/4: 78% burning_ember
1:46.205 incinerate Fluffy_Pillow 33041.3/168000: 20% mana | 3.1/4: 78% burning_ember
1:47.905 Waiting 0.600 sec 24309.1/168000: 14% mana | 3.3/4: 83% burning_ember
1:48.505 incinerate Fluffy_Pillow 32521.3/168000: 19% mana | 3.3/4: 83% burning_ember
1:50.206 conflagrate Fluffy_Pillow 23802.9/168000: 14% mana | 3.4/4: 85% burning_ember
1:51.210 incinerate Fluffy_Pillow 31144.6/168000: 19% mana | 3.5/4: 88% burning_ember backdraft(3)
1:52.401 chaos_bolt Fluffy_Pillow 25045.8/168000: 15% mana | 3.6/4: 90% burning_ember backdraft(2)
1:54.523 incinerate Fluffy_Pillow 54089.6/168000: 32% mana | 2.6/4: 65% burning_ember backdraft(2)
1:55.713 incinerate Fluffy_Pillow 47977.1/168000: 29% mana | 2.7/4: 68% burning_ember backdraft
1:56.905 immolate Fluffy_Pillow 41892.0/168000: 25% mana | 2.8/4: 70% burning_ember
1:58.181 incinerate Fluffy_Pillow 40156.6/168000: 24% mana | 2.8/4: 70% burning_ember mark_of_the_thunderlord
1:59.881 Waiting 0.100 sec 31424.4/168000: 19% mana | 3.1/4: 78% burning_ember mark_of_the_thunderlord
1:59.981 incinerate Fluffy_Pillow 32793.1/168000: 20% mana | 3.1/4: 78% burning_ember mark_of_the_thunderlord
2:01.681 dark_soul Fluffy_Pillow 24061.0/168000: 14% mana | 3.2/4: 80% burning_ember mark_of_the_thunderlord
2:01.681 chaos_bolt Fluffy_Pillow 16061.0/168000: 10% mana | 3.2/4: 80% burning_ember dark_soul, mark_of_the_thunderlord
2:03.804 chaos_bolt Fluffy_Pillow 45118.5/168000: 27% mana | 2.3/4: 58% burning_ember dark_soul, mark_of_the_thunderlord
2:05.928 chaos_bolt Fluffy_Pillow 74189.6/168000: 44% mana | 1.3/4: 33% burning_ember dark_soul, mark_of_the_thunderlord
2:08.049 conflagrate Fluffy_Pillow 103219.7/168000: 61% mana | 0.4/4: 10% burning_ember dark_soul, mark_of_the_thunderlord
2:09.056 incinerate Fluffy_Pillow 110602.5/168000: 66% mana | 0.6/4: 15% burning_ember backdraft(3), dark_soul, mark_of_the_thunderlord
2:10.248 incinerate Fluffy_Pillow 104517.4/168000: 62% mana | 0.8/4: 20% burning_ember backdraft(2), dark_soul, mark_of_the_thunderlord
2:11.437 chaos_bolt Fluffy_Pillow 98391.2/168000: 59% mana | 1.1/4: 28% burning_ember backdraft, dark_soul, mark_of_the_thunderlord
2:13.559 immolate Fluffy_Pillow 127435.0/168000: 76% mana | 0.1/4: 3% burning_ember backdraft, dark_soul, mark_of_the_thunderlord
2:14.834 conflagrate Fluffy_Pillow 125685.9/168000: 75% mana | 0.3/4: 8% burning_ember backdraft, dark_soul, mark_of_the_thunderlord
2:15.838 incinerate Fluffy_Pillow 133027.6/168000: 79% mana | 0.4/4: 10% burning_ember backdraft(4), dark_soul, mark_of_the_thunderlord
2:17.030 incinerate Fluffy_Pillow 126942.5/168000: 76% mana | 0.7/4: 18% burning_ember backdraft(3), dark_soul, mark_of_the_thunderlord
2:18.220 incinerate Fluffy_Pillow 120830.0/168000: 72% mana | 0.8/4: 20% burning_ember backdraft(2), dark_soul, mark_of_the_thunderlord
2:19.412 chaos_bolt Fluffy_Pillow 114744.9/168000: 68% mana | 1.0/4: 25% burning_ember backdraft, dark_soul, mark_of_the_thunderlord
2:21.533 incinerate Fluffy_Pillow 143775.0/168000: 86% mana | 0.1/4: 3% burning_ember backdraft, dark_soul, mark_of_the_thunderlord
2:22.724 incinerate Fluffy_Pillow 137676.2/168000: 82% mana | 0.3/4: 8% burning_ember mark_of_the_thunderlord
2:24.423 incinerate Fluffy_Pillow 128930.4/168000: 77% mana | 0.4/4: 10% burning_ember mark_of_the_thunderlord
2:26.123 conflagrate Fluffy_Pillow 120198.2/168000: 72% mana | 0.6/4: 15% burning_ember mark_of_the_thunderlord
2:27.127 immolate Fluffy_Pillow 127540.0/168000: 76% mana | 0.7/4: 18% burning_ember backdraft(3), mark_of_the_thunderlord
2:28.402 incinerate Fluffy_Pillow 125790.9/168000: 75% mana | 0.8/4: 20% burning_ember backdraft(3), mark_of_the_thunderlord
2:29.592 incinerate Fluffy_Pillow 119678.4/168000: 71% mana | 1.0/4: 25% burning_ember backdraft(2), mark_of_the_thunderlord
2:30.785 incinerate Fluffy_Pillow 113607.0/168000: 68% mana | 1.1/4: 28% burning_ember backdraft, mark_of_the_thunderlord
2:31.977 incinerate Fluffy_Pillow 107521.8/168000: 64% mana | 1.3/4: 33% burning_ember mark_of_the_thunderlord
2:33.677 incinerate Fluffy_Pillow 98789.7/168000: 59% mana | 1.4/4: 35% burning_ember mark_of_the_thunderlord
2:35.376 incinerate Fluffy_Pillow 90043.9/168000: 54% mana | 1.5/4: 38% burning_ember
2:37.075 incinerate Fluffy_Pillow 81298.1/168000: 48% mana | 1.7/4: 43% burning_ember
2:38.775 conflagrate Fluffy_Pillow 72565.9/168000: 43% mana | 1.8/4: 45% burning_ember
2:39.781 incinerate Fluffy_Pillow 79935.0/168000: 48% mana | 2.0/4: 50% burning_ember backdraft(3)
2:40.971 incinerate Fluffy_Pillow 73822.6/168000: 44% mana | 2.1/4: 53% burning_ember backdraft(2)
2:42.161 immolate Fluffy_Pillow 67710.1/168000: 40% mana | 2.2/4: 55% burning_ember backdraft
2:43.438 incinerate Fluffy_Pillow 65988.3/168000: 39% mana | 2.2/4: 55% burning_ember backdraft
2:44.630 incinerate Fluffy_Pillow 59903.2/168000: 36% mana | 2.3/4: 58% burning_ember
2:46.328 incinerate Fluffy_Pillow 51143.7/168000: 30% mana | 2.4/4: 60% burning_ember
2:48.029 incinerate Fluffy_Pillow 42425.3/168000: 25% mana | 2.6/4: 65% burning_ember
2:49.731 conflagrate Fluffy_Pillow 33720.5/168000: 20% mana | 2.7/4: 68% burning_ember
2:50.737 incinerate Fluffy_Pillow 41089.6/168000: 24% mana | 2.8/4: 70% burning_ember backdraft(3)
2:51.927 incinerate Fluffy_Pillow 34977.1/168000: 21% mana | 2.9/4: 73% burning_ember backdraft(2)
2:53.116 incinerate Fluffy_Pillow 28851.0/168000: 17% mana | 3.0/4: 75% burning_ember backdraft
2:54.307 Waiting 0.700 sec 22752.2/168000: 14% mana | 3.1/4: 78% burning_ember
2:55.007 incinerate Fluffy_Pillow 32333.0/168000: 19% mana | 3.1/4: 78% burning_ember
2:56.706 Waiting 0.100 sec 23587.2/168000: 14% mana | 3.2/4: 80% burning_ember mark_of_the_thunderlord
2:56.806 immolate Fluffy_Pillow 24955.9/168000: 15% mana | 3.2/4: 80% burning_ember mark_of_the_thunderlord
2:58.081 Waiting 0.700 sec 23206.8/168000: 14% mana | 3.2/4: 80% burning_ember mark_of_the_thunderlord
2:58.781 incinerate Fluffy_Pillow 32787.7/168000: 20% mana | 3.2/4: 80% burning_ember mark_of_the_thunderlord
3:00.480 Waiting 0.600 sec 24041.9/168000: 14% mana | 3.3/4: 83% burning_ember mark_of_the_thunderlord
3:01.080 incinerate Fluffy_Pillow 32254.1/168000: 19% mana | 3.3/4: 83% burning_ember mark_of_the_thunderlord
3:02.778 chaos_bolt Fluffy_Pillow 23494.6/168000: 14% mana | 3.5/4: 88% burning_ember mark_of_the_thunderlord
3:04.900 conflagrate Fluffy_Pillow 52538.4/168000: 31% mana | 2.5/4: 63% burning_ember
3:05.905 incinerate Fluffy_Pillow 59893.8/168000: 36% mana | 2.7/4: 68% burning_ember backdraft(3)
3:07.096 incinerate Fluffy_Pillow 53795.0/168000: 32% mana | 2.8/4: 70% burning_ember backdraft(2)
3:08.287 incinerate Fluffy_Pillow 47696.2/168000: 28% mana | 2.9/4: 73% burning_ember backdraft
3:09.479 incinerate Fluffy_Pillow 41611.1/168000: 25% mana | 3.0/4: 75% burning_ember
3:11.179 incinerate Fluffy_Pillow 32878.9/168000: 20% mana | 3.2/4: 80% burning_ember
3:12.878 immolate Fluffy_Pillow 24133.1/168000: 14% mana | 3.3/4: 83% burning_ember
3:14.153 conflagrate Fluffy_Pillow 22384.0/168000: 13% mana | 3.3/4: 83% burning_ember
3:15.157 incinerate Fluffy_Pillow 29725.7/168000: 18% mana | 3.5/4: 88% burning_ember backdraft(3)
3:16.346 chaos_bolt Fluffy_Pillow 23599.6/168000: 14% mana | 3.6/4: 90% burning_ember backdraft(2)
3:18.470 incinerate Fluffy_Pillow 52670.7/168000: 31% mana | 2.6/4: 65% burning_ember backdraft(2)
3:19.661 incinerate Fluffy_Pillow 46571.9/168000: 28% mana | 2.7/4: 68% burning_ember backdraft
3:20.851 incinerate Fluffy_Pillow 40459.4/168000: 24% mana | 2.8/4: 70% burning_ember
3:22.551 Waiting 0.100 sec 31727.3/168000: 19% mana | 2.9/4: 73% burning_ember
3:22.651 incinerate Fluffy_Pillow 33096.0/168000: 20% mana | 2.9/4: 73% burning_ember
3:24.352 Waiting 0.600 sec 24377.6/168000: 15% mana | 3.0/4: 75% burning_ember
3:24.952 incinerate Fluffy_Pillow 32589.7/168000: 19% mana | 3.0/4: 75% burning_ember
3:26.651 conflagrate Fluffy_Pillow 23843.9/168000: 14% mana | 3.1/4: 78% burning_ember
3:27.655 immolate Fluffy_Pillow 31185.7/168000: 19% mana | 3.2/4: 80% burning_ember backdraft(3)
3:28.931 incinerate Fluffy_Pillow 29450.2/168000: 18% mana | 3.2/4: 80% burning_ember backdraft(3)
3:30.121 incinerate Fluffy_Pillow 23337.8/168000: 14% mana | 3.4/4: 85% burning_ember backdraft(2)
3:31.313 chaos_bolt Fluffy_Pillow 17252.6/168000: 10% mana | 3.5/4: 88% burning_ember backdraft
3:33.437 incinerate Fluffy_Pillow 46323.8/168000: 28% mana | 2.5/4: 63% burning_ember backdraft
3:34.628 incinerate Fluffy_Pillow 40225.0/168000: 24% mana | 2.6/4: 65% burning_ember
3:36.328 Waiting 0.100 sec 31492.9/168000: 19% mana | 2.8/4: 70% burning_ember
3:36.428 incinerate Fluffy_Pillow 32861.6/168000: 20% mana | 2.8/4: 70% burning_ember
3:38.127 conflagrate Fluffy_Pillow 24115.7/168000: 14% mana | 2.9/4: 73% burning_ember
3:39.131 incinerate Fluffy_Pillow 31457.5/168000: 19% mana | 3.1/4: 78% burning_ember backdraft(3)
3:40.321 incinerate Fluffy_Pillow 25345.0/168000: 15% mana | 3.2/4: 80% burning_ember backdraft(2), mark_of_the_thunderlord
3:41.512 Waiting 0.300 sec 19246.2/168000: 11% mana | 3.4/4: 85% burning_ember backdraft, mark_of_the_thunderlord
3:41.812 immolate Fluffy_Pillow 23352.3/168000: 14% mana | 3.4/4: 85% burning_ember backdraft, mark_of_the_thunderlord
3:43.089 Waiting 0.100 sec 21630.5/168000: 13% mana | 3.4/4: 85% burning_ember backdraft, mark_of_the_thunderlord
3:43.189 incinerate Fluffy_Pillow 22999.2/168000: 14% mana | 3.4/4: 85% burning_ember backdraft, mark_of_the_thunderlord
3:44.380 chaos_bolt Fluffy_Pillow 16900.4/168000: 10% mana | 3.5/4: 88% burning_ember mark_of_the_thunderlord
3:46.502 incinerate Fluffy_Pillow 45944.2/168000: 27% mana | 2.5/4: 63% burning_ember mark_of_the_thunderlord
3:48.202 incinerate Fluffy_Pillow 37212.1/168000: 22% mana | 2.7/4: 68% burning_ember mark_of_the_thunderlord
3:49.902 conflagrate Fluffy_Pillow 28480.0/168000: 17% mana | 2.8/4: 70% burning_ember mark_of_the_thunderlord
3:50.908 incinerate Fluffy_Pillow 35849.1/168000: 21% mana | 2.9/4: 73% burning_ember backdraft(3), mark_of_the_thunderlord
3:52.099 incinerate Fluffy_Pillow 29750.3/168000: 18% mana | 3.0/4: 75% burning_ember backdraft(2), mark_of_the_thunderlord
3:53.290 incinerate Fluffy_Pillow 23651.5/168000: 14% mana | 3.2/4: 80% burning_ember backdraft
3:54.481 Waiting 1.100 sec 17552.7/168000: 10% mana | 3.4/4: 85% burning_ember
3:55.581 incinerate Fluffy_Pillow 32608.3/168000: 19% mana | 3.4/4: 85% burning_ember
3:57.282 chaos_bolt Fluffy_Pillow 23889.9/168000: 14% mana | 3.5/4: 88% burning_ember
3:59.404 potion Fluffy_Pillow 52933.7/168000: 32% mana | 2.6/4: 65% burning_ember
3:59.404 immolate Fluffy_Pillow 52933.7/168000: 32% mana | 2.6/4: 65% burning_ember draenic_intellect_potion
4:00.678 incinerate Fluffy_Pillow 51170.9/168000: 30% mana | 2.6/4: 65% burning_ember draenic_intellect_potion
4:02.379 dark_soul Fluffy_Pillow 42452.4/168000: 25% mana | 2.8/4: 70% burning_ember draenic_intellect_potion
4:02.379 chaos_bolt Fluffy_Pillow 34452.4/168000: 21% mana | 2.8/4: 70% burning_ember dark_soul, draenic_intellect_potion
4:04.500 chaos_bolt Fluffy_Pillow 63482.5/168000: 38% mana | 1.8/4: 45% burning_ember dark_soul, draenic_intellect_potion
4:06.623 conflagrate Fluffy_Pillow 92540.0/168000: 55% mana | 0.9/4: 23% burning_ember dark_soul, draenic_intellect_potion
4:07.626 incinerate Fluffy_Pillow 99868.0/168000: 59% mana | 1.0/4: 25% burning_ember backdraft(3), dark_soul, draenic_intellect_potion
4:08.816 chaos_bolt Fluffy_Pillow 93755.6/168000: 56% mana | 1.1/4: 28% burning_ember backdraft(2), dark_soul, draenic_intellect_potion
4:10.938 incinerate Fluffy_Pillow 122799.3/168000: 73% mana | 0.1/4: 3% burning_ember backdraft(2), dark_soul, draenic_intellect_potion
4:12.130 immolate Fluffy_Pillow 116714.2/168000: 69% mana | 0.2/4: 5% burning_ember backdraft, dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
4:13.406 conflagrate Fluffy_Pillow 114978.8/168000: 68% mana | 0.3/4: 8% burning_ember backdraft, dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
4:14.412 incinerate Fluffy_Pillow 122347.9/168000: 73% mana | 0.4/4: 10% burning_ember backdraft(4), dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
4:15.601 incinerate Fluffy_Pillow 116221.7/168000: 69% mana | 0.6/4: 15% burning_ember backdraft(3), dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
4:16.791 incinerate Fluffy_Pillow 110109.2/168000: 66% mana | 0.9/4: 23% burning_ember backdraft(2), dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
4:17.983 chaos_bolt Fluffy_Pillow 104024.1/168000: 62% mana | 1.0/4: 25% burning_ember backdraft, dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
4:20.105 incinerate Fluffy_Pillow 133067.9/168000: 79% mana | 0.1/4: 3% burning_ember backdraft, dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
4:21.295 incinerate Fluffy_Pillow 126955.4/168000: 76% mana | 0.4/4: 10% burning_ember dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
4:22.993 incinerate Fluffy_Pillow 118195.9/168000: 70% mana | 0.6/4: 15% burning_ember mark_of_the_thunderlord, draenic_intellect_potion
4:24.692 incinerate Fluffy_Pillow 109450.1/168000: 65% mana | 0.7/4: 18% burning_ember
4:26.391 conflagrate Fluffy_Pillow 100704.3/168000: 60% mana | 0.8/4: 20% burning_ember
4:27.396 immolate Fluffy_Pillow 108059.7/168000: 64% mana | 0.9/4: 23% burning_ember backdraft(3)
4:28.672 incinerate Fluffy_Pillow 106324.3/168000: 63% mana | 0.9/4: 23% burning_ember backdraft(3)
4:29.862 incinerate Fluffy_Pillow 100211.8/168000: 60% mana | 1.0/4: 25% burning_ember backdraft(2)
4:31.053 incinerate Fluffy_Pillow 94113.0/168000: 56% mana | 1.2/4: 30% burning_ember backdraft
4:32.243 incinerate Fluffy_Pillow 88000.5/168000: 52% mana | 1.3/4: 33% burning_ember
4:33.943 incinerate Fluffy_Pillow 79268.4/168000: 47% mana | 1.5/4: 38% burning_ember
4:35.642 chaos_bolt Fluffy_Pillow 70522.5/168000: 42% mana | 1.7/4: 43% burning_ember
4:37.764 conflagrate Fluffy_Pillow 99566.3/168000: 59% mana | 0.8/4: 20% burning_ember
4:38.770 incinerate Fluffy_Pillow 106935.4/168000: 64% mana | 0.9/4: 23% burning_ember backdraft(3), mark_of_the_thunderlord
4:39.960 chaos_bolt Fluffy_Pillow 100822.9/168000: 60% mana | 1.1/4: 28% burning_ember backdraft(2), mark_of_the_thunderlord
4:42.081 immolate Fluffy_Pillow 129853.0/168000: 77% mana | 0.1/4: 3% burning_ember backdraft(2), mark_of_the_thunderlord
4:43.356 incinerate Fluffy_Pillow 128103.9/168000: 76% mana | 0.1/4: 3% burning_ember backdraft(2), mark_of_the_thunderlord
4:44.547 incinerate Fluffy_Pillow 122005.1/168000: 73% mana | 0.3/4: 8% burning_ember backdraft, mark_of_the_thunderlord
4:45.736 incinerate Fluffy_Pillow 115879.0/168000: 69% mana | 0.4/4: 10% burning_ember mark_of_the_thunderlord
4:47.435 incinerate Fluffy_Pillow 107133.1/168000: 64% mana | 0.6/4: 15% burning_ember mark_of_the_thunderlord
4:49.133 incinerate Fluffy_Pillow 98373.6/168000: 59% mana | 0.7/4: 18% burning_ember mark_of_the_thunderlord
4:50.834 conflagrate Fluffy_Pillow 89655.2/168000: 53% mana | 0.8/4: 20% burning_ember
4:51.839 incinerate Fluffy_Pillow 97010.6/168000: 58% mana | 0.9/4: 23% burning_ember backdraft(3)
4:53.030 chaos_bolt Fluffy_Pillow 90911.8/168000: 54% mana | 1.0/4: 25% burning_ember backdraft(2)
4:55.154 incinerate Fluffy_Pillow 119983.0/168000: 71% mana | 0.0/4: 0% burning_ember backdraft(2)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 573 546 546
Agility 1036 987 987
Stamina 5071 4610 4191
Intellect 4308 3840 3710 (2613)
Spirit 1155 1155 1155
Health 304260 276600 0
Mana 168000 168000 0
Burning Ember 4 4 0
Spell Power 6356 5310 1470
Crit 21.45% 15.49% 1154
Haste 17.99% 12.37% 1126
Multistrike 19.82% 14.82% 978
Damage / Heal Versatility 3.60% 0.60% 78
ManaReg per Second 13687 13035 0
Mastery 47.31% 32.31% 305
Armor 671 671 661

Talents

Level
15 Dark Regeneration Soul Leech Searing Flames (Destruction Warlock)
30 Howl of Terror Mortal Coil Shadowfury
45 Soul Link Sacrificial Pact Dark Bargain
60 Blood Horror Burning Rush Unbound Will
75 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
90 Archimonde's Darkness Kil'jaeden's Cunning Mannoroth's Fury
100 Charred Remains Cataclysm Demonic Servitude

Profile

warlock="Candylicious"
origin="http://eu.battle.net/wow/en/character/forscherliga/Candylicious/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/213/75883733-avatar.jpg"
level=100
race=gnome
role=spell
position=back
professions=tailoring=700/inscription=189
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Vb!1200012
glyphs=siphon_life/havoc/demon_training/nightmares/verdant_spheres
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_intellect_flask
actions.precombat+=/food,type=blackrock_barbecue
actions.precombat+=/dark_intent,if=!aura.spell_power_multiplier.up
actions.precombat+=/summon_pet,if=!talent.demonic_servitude.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.grimoire_of_sacrifice.down)
actions.precombat+=/summon_doomguard,if=talent.demonic_servitude.enabled&active_enemies<5
actions.precombat+=/summon_infernal,if=talent.demonic_servitude.enabled&active_enemies>=5
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled&!talent.demonic_servitude.enabled
actions.precombat+=/service_pet,if=talent.grimoire_of_service.enabled
actions.precombat+=/potion,name=draenic_intellect
actions.precombat+=/incinerate

# Executed every time the actor is available.

actions=potion,name=draenic_intellect,if=buff.bloodlust.react|target.health.pct<=20
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/mannoroths_fury
actions+=/dark_soul,if=!talent.archimondes_darkness.enabled|(talent.archimondes_darkness.enabled&(charges=2|trinket.proc.intellect.react|trinket.stacking_proc.intellect.react>6|target.health.pct<=10))
actions+=/service_pet,if=talent.grimoire_of_service.enabled
actions+=/summon_doomguard,if=!talent.demonic_servitude.enabled&active_enemies<5
actions+=/summon_infernal,if=!talent.demonic_servitude.enabled&active_enemies>=5
actions+=/run_action_list,name=single_target,if=active_enemies<6
actions+=/run_action_list,name=aoe,if=active_enemies>=6

actions.single_target=havoc,target=2
actions.single_target+=/shadowburn,if=talent.charred_remains.enabled&(burning_ember>=2.5|buff.dark_soul.up|target.time_to_die<10)
actions.single_target+=/cataclysm,if=active_enemies>1
actions.single_target+=/fire_and_brimstone,if=buff.fire_and_brimstone.down&dot.immolate.remains<=action.immolate.cast_time&(cooldown.cataclysm.remains>action.immolate.cast_time|!talent.cataclysm.enabled)&active_enemies>4
actions.single_target+=/immolate,cycle_targets=1,if=remains<=cast_time&(cooldown.cataclysm.remains>cast_time|!talent.cataclysm.enabled)
actions.single_target+=/cancel_buff,name=fire_and_brimstone,if=buff.fire_and_brimstone.up&dot.immolate.remains>(dot.immolate.duration*0.3)
actions.single_target+=/shadowburn,if=buff.havoc.remains
actions.single_target+=/chaos_bolt,if=buff.havoc.remains>cast_time&buff.havoc.stack>=3
actions.single_target+=/conflagrate,if=charges=2
actions.single_target+=/cataclysm
actions.single_target+=/rain_of_fire,if=remains<=tick_time&(active_enemies>4|(buff.mannoroths_fury.up&active_enemies>2))
actions.single_target+=/chaos_bolt,if=talent.charred_remains.enabled&active_enemies>1&target.health.pct>20
actions.single_target+=/chaos_bolt,if=talent.charred_remains.enabled&buff.backdraft.stack<3&burning_ember>=2.5
actions.single_target+=/chaos_bolt,if=buff.backdraft.stack<3&(burning_ember>=3.5|buff.dark_soul.up|(burning_ember>=3&buff.ember_master.react)|target.time_to_die<20)
actions.single_target+=/chaos_bolt,if=buff.backdraft.stack<3&set_bonus.tier17_2pc=1&burning_ember>=2.5
actions.single_target+=/chaos_bolt,if=buff.backdraft.stack<3&buff.archmages_greater_incandescence_int.react&buff.archmages_greater_incandescence_int.remains>cast_time
actions.single_target+=/chaos_bolt,if=buff.backdraft.stack<3&trinket.proc.intellect.react&trinket.proc.intellect.remains>cast_time
actions.single_target+=/chaos_bolt,if=buff.backdraft.stack<3&trinket.stacking_proc.intellect.react>7&trinket.stacking_proc.intellect.remains>=cast_time
actions.single_target+=/chaos_bolt,if=buff.backdraft.stack<3&trinket.proc.crit.react&trinket.proc.crit.remains>cast_time
actions.single_target+=/chaos_bolt,if=buff.backdraft.stack<3&trinket.stacking_proc.multistrike.react>=8&trinket.stacking_proc.multistrike.remains>=cast_time
actions.single_target+=/chaos_bolt,if=buff.backdraft.stack<3&trinket.proc.multistrike.react&trinket.proc.multistrike.remains>cast_time
actions.single_target+=/chaos_bolt,if=buff.backdraft.stack<3&trinket.proc.versatility.react&trinket.proc.versatility.remains>cast_time
actions.single_target+=/chaos_bolt,if=buff.backdraft.stack<3&trinket.proc.mastery.react&trinket.proc.mastery.remains>cast_time
actions.single_target+=/fire_and_brimstone,if=buff.fire_and_brimstone.down&dot.immolate.remains<=(dot.immolate.duration*0.3)&active_enemies>4
actions.single_target+=/immolate,cycle_targets=1,if=remains<=(duration*0.3)
actions.single_target+=/conflagrate
actions.single_target+=/incinerate

actions.aoe=rain_of_fire,if=remains<=tick_time
actions.aoe+=/havoc,target=2
actions.aoe+=/shadowburn,if=buff.havoc.remains
actions.aoe+=/chaos_bolt,if=buff.havoc.remains>cast_time&buff.havoc.stack>=3
actions.aoe+=/cataclysm
actions.aoe+=/fire_and_brimstone,if=buff.fire_and_brimstone.down
actions.aoe+=/immolate,if=buff.fire_and_brimstone.up&!dot.immolate.ticking
actions.aoe+=/conflagrate,if=buff.fire_and_brimstone.up&charges=2
actions.aoe+=/immolate,if=buff.fire_and_brimstone.up&dot.immolate.remains<=(dot.immolate.duration*0.3)
actions.aoe+=/chaos_bolt,if=talent.charred_remains.enabled&buff.fire_and_brimstone.up&burning_ember>=2.5
actions.aoe+=/incinerate

head=crown_of_power,id=118942
neck=odyssian_choker,id=113833,bonus_id=566,enchant=75crit
shoulders=mantle_of_volatile_ice,id=114517,bonus_id=148/560
back=cloak_of_searing_shadows,id=113847,enchant=gift_of_critical_strike
chest=robes_of_necrotic_whispers,id=113655,bonus_id=566
tabard=gnomeregan_tabard,id=45578
wrists=bracers_of_volatile_ice,id=114493,bonus_id=130
hands=meatmongers_gory_grips,id=113610
waist=cord_of_winsome_sorrows,id=119336
legs=seacursed_leggings,id=113828,bonus_id=561/566
feet=sandals_of_volatile_ice,id=114501,bonus_id=37
finger1=timeless_solium_band_of_the_archmage,id=118296,enchant=30crit
finger2=kargaths_last_link,id=113604,bonus_id=566,enchant=50crit
trinket1=quiescent_runestone,id=113859
trinket2=grandiose_power,id=114550,bonus_id=40/563,gems=50crit
main_hand=spire_of_tectus,id=113639,bonus_id=561/566,enchant=mark_of_the_thunderlord

# Gear Summary
# gear_stamina=3301
# gear_intellect=2613
# gear_spell_power=1470
# gear_crit_rating=1099
# gear_haste_rating=1126
# gear_mastery_rating=305
# gear_armor=661
# gear_multistrike_rating=978
# gear_versatility_rating=78
# gear_avoidance_rating=82
default_pet=felhunter

Dârkride

Dârkride : 22243 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
22242.7 22242.7 7.8 / 0.035% 2422.8 / 10.9% 2603.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.5 8.5 Rage 0.00% 92.3 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Dârkride/advanced
Talents
  • 15: Double Time
  • 30: Enraged Regeneration
  • 45: Unyielding Strikes (Protection Warrior)
  • 60: Dragon Roar
  • 75: Vigilance
  • 90: Bloodbath
  • 100: Gladiator's Resolve (Protection Warrior)
  • Talent Calculator
Glyphs
  • Glyph of Enraged Speed
  • Glyph of Cleave
  • Glyph of Bull Rush
  • Glyph of Gushing Wound
  • Glyph of Bloodcurdling Shout
  • Glyph of Mystic Shout
Professions
  • mining: 700
  • blacksmithing: 666

Charts

http://3.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=D%C3%A2rkride+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x210&chd=t:22958|22892|15565|14139|8300|2466&chds=0,45916&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++22958++execute,C79C6E,0,0,15|t++22892++dragon_roar,C79C6E,1,0,15|t++15565++shield_slam,C79C6E,2,0,15|t++14139++revenge,C79C6E,3,0,15|t++8300++devastate,C79C6E,4,0,15|t++2466++auto_attack_mh,C79C6E,5,0,15& http://4.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=D%C3%A2rkride+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:20,20,18,11,9,8,6,3,2,2,0&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=shield_slam|devastate|heroic_strike|auto_attack_mh|deep_wounds|revenge|bloodbath|execute|dragon_roar|shattered_bleed|heroic_leap&
http://6.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=D%C3%A2rkride+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:hkorsvz158663331zzywvtrqronljjjiihghhffgfeddddddcbccbfghgjjkjlmlmpporsrpsppnnmkjkjgihgefedcdcbZbbacccacbcbbcaabcadeedffgfghggijhkkkjjjighgfdffdeddbdccabcaabbabcbabbbabbaZbbZccdcdeddefdeggfghhfhgfeefcdddbcdcbcbaabbabbcZcccaccabbcbcddbdfeeggggiihjjkillkjkjhhihfggfdfedbdcbbccbcccbcdcbdcbbccbccdbddcdeedefgfghhghhggihggggefffdeeccdcccddbccdbdcbbcdbdcdccddceeddfeefeeccaYWWUSQQN&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.553643,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=22243|max=40175&chxp=1,1,55,100 Resolve Timeline Chart http://9.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=D%C3%A2rkride+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:3,1,8,4,11,18,45,75,111,165,248,350,489,662,861,958,1135,1284,1460,1574,1579,1560,1564,1508,1359,1310,1197,999,884,767,658,533,433,325,263,186,129,94,64,45,39,12,10,5,7,5,1,1,0,1&chds=0,1579&chbh=5&chxt=x&chxl=0:|min=20010|avg=22243|max=25038&chxp=0,1,44,100& http://5.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=D%C3%A2rkride+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:52.6,29.2,13.2,2.9,2.3&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=devastate 158.2s|shield_slam 87.9s|revenge 39.7s|execute 8.8s|dragon_roar 7.0s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Dârkride 22243
auto_attack_mh 2464 11.1% 133.3 2.27sec 5550 2466 Direct 133.3 4466 9036 5337 19.0% 17.8 1340 2711 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 133.34 133.34 0.00 0.00 2.2506 0.0000 740070.96 1137372.21 34.93 2466.26 2466.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.38 18.97% 2710.51 2374 3417 2617.81 0 3417 9152 14065 33.72
multistrike 14.42 81.03% 1339.77 1187 1708 1340.80 1202 1604 19320 29691 34.93
hit 107.94 80.95% 4466.50 3956 5694 4470.02 4308 4642 482095 740904 34.93
crit 25.40 19.05% 9035.76 7913 11389 9044.26 8308 10150 229505 352712 34.93
 
DPS Timeline Chart
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
bloodbath 1266 5.7% 5.5 60.04sec 68637 0 Periodic 92.2 4114 0 4114 0.0% 0.0 0 0 0.0% 30.6%

Stats details: bloodbath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.53 5.53 92.18 92.18 0.0000 1.0000 379259.98 379259.98 0.00 4114.43 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.53 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 92.2 100.00% 4114.44 357 11485 4124.38 3257 5310 379260 379260 0.00
 
DPS Timeline Chart
 

Action details: bloodbath

Static Values
  • id:113344
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113344
  • name:Bloodbath
  • school:physical
  • tooltip:Bleeding for $w1 every $t1 sec.
  • description:{$@spelldesc12292=For the next {$12292d=12 seconds}, your melee damage abilities and their multistrikes deal {$12292s1=30}% additional damage as a bleed over {$113344d=6 seconds}. While bleeding, targets move {$147531s1=50}% slower.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
deep_wounds 1963 8.8% 120.9 2.47sec 4882 0 Periodic 98.7 4828 9737 5752 18.8% 13.2 1448 2921 18.9% 98.4%

Stats details: deep_wounds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 120.89 120.89 98.66 98.66 0.0000 3.0000 590248.22 590248.22 0.00 1994.27 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 120.89 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.5 18.87% 2920.51 2567 3823 2672.76 0 3823 7263 7263 0.00
multistrike 10.7 81.13% 1448.16 1283 1912 1449.42 1283 1912 15485 15485 0.00
hit 80.1 81.18% 4828.45 4278 6372 4832.79 4647 5072 386708 386708 0.00
crit 18.6 18.82% 9736.71 8556 12744 9746.38 8819 11411 180793 180793 0.00
 
DPS Timeline Chart
 

Action details: deep_wounds

Static Values
  • id:115767
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115767
  • name:Deep Wounds
  • school:physical
  • tooltip:Bleeding for $w1 every $t1 sec. Cancelled if target reaches full health.
  • description:Your Mortal Strike, Bloodthirst, Devastate, and Thunder Clap cause the target to bleed for $115767o1 Physical damage over {$115767d=15 seconds}. This effect is cancelled if the target reaches full health.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.600000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
devastate 4371 19.6% 120.9 2.47sec 10859 8300 Direct 120.9 8732 17702 10441 19.1% 16.1 2620 5309 19.1%  

Stats details: devastate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 120.89 120.89 0.00 0.00 1.3083 0.0000 1312799.13 2017564.98 34.93 8300.03 8300.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.08 19.11% 5309.15 4652 6679 5046.05 0 6679 16364 25148 33.19
multistrike 13.05 80.89% 2619.78 2326 3339 2621.55 2365 3184 34186 52538 34.93
hit 97.86 80.94% 8731.59 7754 11131 8739.68 8421 9107 854436 1313133 34.93
crit 23.04 19.06% 17701.81 15507 22262 17708.62 16089 20020 407814 626745 34.93
 
DPS Timeline Chart
 

Action details: devastate

Static Values
  • id:20243
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.unyielding_strikes.stack>0&buff.unyielding_strikes.stack<6&buff.unyielding_strikes.remains<1.5
Spelldata
  • id:20243
  • name:Devastate
  • school:physical
  • tooltip:
  • description:Deals $sw1 Physical damage, and has a {$46953s1=30}% chance to reset the cooldown on Shield Slam and cause it to generate $/10;50227s1 more Rage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.10
 
dragon_roar 536 2.4% 5.4 61.14sec 29894 22892 Direct 5.4 0 28755 28755 100.0% 0.7 0 8636 100.0%  

Stats details: dragon_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.37 5.37 0.00 0.00 1.3060 0.0000 160562.08 160562.08 0.00 22891.66 22891.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.71 100.00% 8636.22 7057 10511 4481.31 0 10511 6117 6117 0.00
crit 5.37 100.00% 28754.87 23522 35038 28812.00 26693 30456 154445 154445 0.00
 
DPS Timeline Chart
 

Action details: dragon_roar

Static Values
  • id:118000
  • school:physical
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118000
  • name:Dragon Roar
  • school:physical
  • tooltip:
  • description:Roar explosively, dealing {$?s12712=false}[${$m1*1.25}][$m1] damage to all enemies within $A1 yards and knocking them back and down for {$118895d=500 milliseconds}. Damage ignores all armor and is always a critical strike.
 
execute 671 3.0% 6.5 7.91sec 31324 22958 Direct 6.5 25404 50860 30124 18.5% 0.9 7620 15250 18.5%  

Stats details: execute

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.46 6.46 0.00 0.00 1.3645 0.0000 202376.52 311020.76 34.93 22958.20 22958.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.16 18.46% 15250.42 14178 15596 2235.60 0 15596 2417 3715 5.12
multistrike 0.70 81.54% 7620.38 7089 7798 3837.07 0 7798 5335 8199 17.59
hit 5.26 81.46% 25403.65 23630 25993 25391.73 0 25993 133694 205466 34.92
crit 1.20 18.54% 50860.26 47260 51986 36860.57 0 51986 60930 93640 25.32
 
DPS Timeline Chart
 

Action details: execute

Static Values
  • id:5308
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.sudden_death.react
Spelldata
  • id:5308
  • name:Execute
  • school:physical
  • tooltip:
  • description:Attempt to finish off a wounded foe, causing $sw2 Physical damage{$?s23881=false}[ with your main-hand and $163558sw2 Physical damage with your off-hand][]. Only usable on enemies that have less than 20% health.{$?s146971=false}[ Successfully killing an enemy with Execute grants you {$147352s1=300 + 100.0%} rage.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.20
 
heroic_leap 78 0.4% 6.9 46.05sec 3422 0 Direct 6.9 2729 5632 3294 19.5% 0.9 820 1684 19.1%  

Stats details: heroic_leap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.87 6.86 0.00 0.00 0.0000 0.0000 23507.03 36126.60 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.17 19.15% 1684.36 1447 2156 272.12 0 2156 294 452 5.64
multistrike 0.74 80.85% 820.14 724 1078 433.22 0 1078 605 930 18.46
hit 5.53 80.54% 2729.19 2412 3593 2729.63 2412 3593 15084 23182 34.93
crit 1.34 19.46% 5632.30 4823 7185 4376.20 0 7185 7523 11562 27.04
 
DPS Timeline Chart
 

Action details: heroic_leap

Static Values
  • id:6544
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.distance>25&raid_event.movement.in>45)|!raid_event.movement.exists
Spelldata
  • id:6544
  • name:Heroic Leap
  • school:physical
  • tooltip:
  • description:Leap through the air toward a targeted location, slamming down with destructive force to deal {$?s12712=false}[${1.2*$52174m1}][$52174m1] Physical damage to all enemies within $52174a1 yards.
 
heroic_strike 4059 18.2% 187.4 1.61sec 6506 0 Direct 187.4 4978 10190 6255 24.5% 25.0 1494 3055 24.5%  

Stats details: heroic_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 187.36 187.36 0.00 0.00 0.0000 0.0000 1218936.53 1873312.99 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 6.13 24.49% 3055.15 2326 4173 3049.81 0 4173 18724 28776 34.85
multistrike 18.90 75.51% 1493.72 1163 2087 1494.95 1263 1877 28226 43378 34.93
hit 141.44 75.49% 4978.02 3876 6956 4982.40 4762 5229 704113 1082110 34.93
crit 45.91 24.51% 10190.31 7752 13911 10199.87 9268 11758 467874 719048 34.93
 
DPS Timeline Chart
 

Action details: heroic_strike

Static Values
  • id:78
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:1.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.shield_charge.up|(buff.unyielding_strikes.up&rage>=50-buff.unyielding_strikes.stack*5))&target.health.pct>20
Spelldata
  • id:78
  • name:Heroic Strike
  • school:physical
  • tooltip:
  • description:Instantly deals $sw2 Physical damage{$?s58366=false}[, reducing the target's movement speed by {$129923s1=50}% for {$129923d=8 seconds}][]. This ability is not on the global cooldown.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.05
 
revenge 1869 8.4% 30.2 10.09sec 18608 14139 Direct 30.2 15000 30280 17889 18.9% 4.0 4496 9092 18.9%  

Stats details: revenge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.18 30.18 0.00 0.00 1.3161 0.0000 561619.85 863121.04 34.93 14139.47 14139.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.76 18.90% 9092.06 7013 13058 4862.80 0 13058 6954 10687 18.67
multistrike 3.28 81.10% 4496.44 3507 6529 4330.36 0 6529 14754 22674 33.63
hit 24.47 81.09% 14999.73 11688 21764 15013.89 13270 16610 367111 564192 34.93
crit 5.71 18.91% 30280.14 23377 43527 30233.28 0 43527 172802 265569 34.84
 
DPS Timeline Chart
 

Action details: revenge

Static Values
  • id:6572
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:6572
  • name:Revenge
  • school:physical
  • tooltip:
  • description:Instantly attack an enemy and two additional enemies, dealing {$s1=1} damage to the primary target and {$s3=50}% damage to the secondary targets, and generating {$/10;s2=20} Rage. Your successful dodges and parries reset the cooldown on Revenge.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.520000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
shattered_bleed 411 1.8% 17.0 17.97sec 7269 0 Direct 17.0 2077 4161 2473 19.0% 2.3 623 1248 18.8%  
Periodic 96.3 796 0 796 0.0% 12.9 243 0 0.0% 32.0%

Stats details: shattered_bleed

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.98 16.98 96.28 96.28 0.0000 1.0000 123458.51 123458.51 0.00 1282.31 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.43 18.83% 1247.85 1165 1281 430.04 0 1281 532 532 0.00
multistrike 1.84 81.17% 622.92 582 641 519.40 0 641 1145 1145 0.00
hit 13.75 80.98% 2076.73 1941 2135 2076.34 1941 2135 28563 28563 0.00
crit 3.23 19.02% 4160.63 3882 4270 3997.67 0 4270 13442 13442 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike 12.9 100.00% 242.62 243 243 242.61 0 243 3124 3124 0.00
hit 96.3 100.00% 796.16 0 809 796.51 769 809 76653 76653 0.00
 
DPS Timeline Chart
 

Action details: shattered_bleed

Static Values
  • id:159238
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:159238
  • name:Shattered Bleed
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2.
  • description:Inflicts {$s1=1500} Bleed damage, plus an additional $o2 damage over {$d=6 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1499.91
  • base_dd_max:1499.91
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:749.87
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
shield_slam 4556 20.5% 66.9 4.52sec 20455 15565 Direct 66.9 16427 33372 19668 19.1% 8.9 4928 10014 19.0%  

Stats details: shield_slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.90 66.90 0.00 0.00 1.3142 0.0000 1368331.70 2102909.77 34.93 15564.61 15564.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.70 19.05% 10014.16 7434 13842 8206.27 0 13842 17032 26176 28.59
multistrike 7.23 80.95% 4927.64 3717 6921 4929.52 0 6921 35618 54740 34.90
hit 54.10 80.87% 16426.92 12390 23069 16445.84 15526 17612 888717 1365817 34.93
crit 12.79 19.13% 33371.80 24779 46139 33400.31 24779 42375 426965 656177 34.93
 
DPS Timeline Chart
 

Action details: shield_slam

Static Values
  • id:23922
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:23922
  • name:Shield Slam
  • school:physical
  • tooltip:
  • description:Slam the target with your shield, causing ${$<shieldslam>} damage{$?s58375=false}[, dispelling 1 magical effect,][] and generating {$/10;s3=20} Rage. Critical strikes with Shield Slam cause your next Heroic Strike to cost no Rage and be a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.671200
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
Dârkride
berserker_rage 9.1 34.55sec

Stats details: berserker_rage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.11 9.11 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.11 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: berserker_rage

Static Values
  • id:18499
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.enrage.down
Spelldata
  • id:18499
  • name:Berserker Rage
  • school:physical
  • tooltip:Immune to Fear, Sap, and Incapacitate effects.
  • description:You go berserk, removing and granting immunity to Fear, Sap and Incapacitate effects for {$d=6 seconds}.
 
blood_craze 17.8 16.12sec

Stats details: blood_craze

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 17.79 0.00 51.12 51.12 0.0000 1.0000 0.00 137177.30 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.1 100.00% 0.00 0 0 0.00 0 0 0 137177 100.00
 
HPS Timeline Chart
 

Action details: blood_craze

Static Values
  • id:159362
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Dârkride
  • harmful:false
  • if_expr:
Spelldata
  • id:159362
  • name:Blood Craze
  • school:physical
  • tooltip:
  • description:Your multistrikes from auto attacks trigger a Blood Craze. Blood Craze regenerates {$s1=3}% of your health over {$159363d=3 seconds}. When this effect is refreshed, the remaining portion is added to the new effect.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
charge 1.0 0.00sec

Stats details: charge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.84 83.52% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.16 16.48% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: charge

Static Values
  • id:100
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:100
  • name:Charge
  • school:physical
  • tooltip:
  • description:Charge to an enemy, {$?s103828=false}[stunning][rooting] it {$?s58377=false}[and {$58377s1=2} additional nearby targets ][]for {$?s103828=false}[{$7922d=1.500 seconds}][{$105771d=1.500 seconds}]. Generates {$/10;s2=20} Rage.
 
draenic_armor_potion 2.0 0.00sec

Stats details: draenic_armor_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156430
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156430
  • name:Draenic Armor Potion
  • school:physical
  • tooltip:Armor increased by {$s1=1500}.
  • description:Increases your bonus armor by {$s1=1500} for {$d=25 seconds}.
 
shield_charge 21.3 14.53sec

Stats details: shield_charge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.27 21.27 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.27 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: shield_charge

Static Values
  • id:156321
  • school:physical
  • resource:rage
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:20.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!buff.shield_charge.up&!cooldown.shield_slam.remains)|charges=2
Spelldata
  • id:156321
  • name:Shield Charge
  • school:physical
  • tooltip:
  • description:Raise your shield and charge a short distance to your target, increasing the damage of Shield Slam, Revenge, and Heroic Strike by {$169667s1=25}% for {$169667d=7 seconds}. Maximum 2 charges.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
berserker_rage 9.1 0.0 34.9sec 34.5sec 18.00% 18.01% 0.0(0.0)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_berserker_rage
  • max_stacks:1
  • duration:6.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • berserker_rage_1:18.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:18499
  • name:Berserker Rage
  • tooltip:Immune to Fear, Sap, and Incapacitate effects.
  • description:You go berserk, removing and granting immunity to Fear, Sap and Incapacitate effects for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:30.00
  • default_chance:0.00%
blood_craze 15.0 2.8 19.4sec 16.2sec 16.53% 16.55% 2.8(2.8)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_blood_craze
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • blood_craze_1:16.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:159363
  • name:Blood Craze
  • tooltip:Regenerating $w1 health every $t1 sec.
  • description:{$@spelldesc159362=Your multistrikes from auto attacks trigger a Blood Craze. Blood Craze regenerates {$s1=3}% of your health over {$159363d=3 seconds}. When this effect is refreshed, the remaining portion is added to the new effect.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
bloodbath 5.5 0.0 60.1sec 60.0sec 21.57% 21.63% 0.0(0.0)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_bloodbath
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodbath_1:21.57%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:12292
  • name:Bloodbath
  • tooltip:Melee special attacks and their multistrikes cause an additional {$12292s1=30}% bleed damage.
  • description:For the next {$12292d=12 seconds}, your melee damage abilities and their multistrikes deal {$12292s1=30}% additional damage as a bleed over {$113344d=6 seconds}. While bleeding, targets move {$147531s1=50}% slower.
  • max_stacks:0
  • duration:12.00
  • cooldown:60.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 33.34% 0.0(0.0)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
draenic_armor_potion 2.0 0.0 59.9sec 0.0sec 15.21% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_draenic_armor_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:bonus_armor
  • amount:1500.00

Stack Uptimes

  • draenic_armor_potion_1:15.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156430
  • name:Draenic Armor Potion
  • tooltip:Armor increased by {$s1=1500}.
  • description:Increases your bonus armor by {$s1=1500} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
enrage 17.8 27.1 17.3sec 6.8sec 76.90% 69.87% 27.1(27.1)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_enrage
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • enrage_1:76.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:12880
  • name:Enrage
  • tooltip:Damage dealt increased by {$s2=10}%.$?$w5!=0[ Movement speed increased by $w5%.][]
  • description:{$@spelldesc13046={$?s23881=false}[Bloodthirst critical strikes][Shield Slam and Devastate critical strikes, critical blocks,] and activating Berserker Rage will Enrage you, generating ${$12880m1/10} Rage and increasing damage done by {$12880s2=10}% for {$12880d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
enraged_speed (enraged_speed) 17.8 27.1 17.3sec 6.8sec 76.90% 76.91% 27.1(27.1)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_enraged_speed
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • enraged_speed_1:76.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:58355
  • name:Glyph of Enraged Speed
  • tooltip:
  • description:While Enraged, you move {$58355s1=20}% faster.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
shield_charge 21.3 0.0 14.4sec 14.5sec 49.13% 57.10% 0.0(0.0)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_shield_charge
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • shield_charge_1:49.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:169667
  • name:Shield Charge
  • tooltip:Increases damage done by your Shield Slam, Revenge, and Heroic Strike abilities by {$s1=25}%.
  • description:{$@spelldesc156321=Raise your shield and charge a short distance to your target, increasing the damage of Shield Slam, Revenge, and Heroic Strike by {$169667s1=25}% for {$169667d=7 seconds}. Maximum 2 charges.}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
spirit_of_the_warlords 3.1 0.0 117.9sec 117.9sec 19.77% 19.79% 0.0(0.0)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_spirit_of_the_warlords
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:crit_rating
  • amount:1396.00

Stack Uptimes

  • spirit_of_the_warlords_1:19.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162915
  • name:Spirit of the Warlords
  • tooltip:Critical strike increased by {$s1=1044}.
  • description:Critical strike increased by {$s1=1044} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
sword_and_board 36.2 0.0 8.1sec 8.1sec 15.73% 53.87% 0.0(0.0)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_sword_and_board
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:30.00%
  • default_value:0.00

Stack Uptimes

  • sword_and_board_1:15.73%

Trigger Attempt Success

  • trigger_pct:30.03%

Spelldata details

  • id:50227
  • name:Sword and Board
  • tooltip:Shield Slam generates $/10;50227s1 more Rage.
  • description:Your Devastate has a {$s1=50}% chance of resetting the cooldown of your Shield Slam and increasing the Rage it generates by $/10;50227s1 for {$50227d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
ultimatum 12.8 0.0 22.5sec 22.6sec 2.82% 2.83% 0.0(0.0)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_ultimatum
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • ultimatum_1:2.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:122510
  • name:Ultimatum
  • tooltip:Your next Heroic Strike costs no Rage and is a critical strike.
  • description:{$@spelldesc122509=Your Shield Slam criticals make your next Heroic Strike cost no Rage and be a guaranteed critical strike.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
unyielding_strikes 16.6 81.2 18.4sec 3.1sec 92.86% 91.83% 0.0(0.0)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_unyielding_strikes
  • max_stacks:6
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-5.00

Stack Uptimes

  • unyielding_strikes_1:13.45%
  • unyielding_strikes_2:13.23%
  • unyielding_strikes_3:12.53%
  • unyielding_strikes_4:13.49%
  • unyielding_strikes_5:13.82%
  • unyielding_strikes_6:26.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:169686
  • name:Unyielding Strikes
  • tooltip:Heroic Strike cost reduced by ${$m1/-10}.
  • description:
  • max_stacks:6
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
gladiator_stance

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_gladiator_stance
  • max_stacks:1
  • duration:0.00
  • cooldown:1.50
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • gladiator_stance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156291
  • name:Gladiator Stance
  • tooltip:An offensive stance that trades all defensive prowess for increase damage dealing. Physical damage dealt increased by {$s1=20}%. Your Shield Block is replaced with Shield Charge.
  • description:A dauntless combat stance. Increases physical damage dealt by {$s1=20}%, and replaces your Shield Block with Shield Charge. You cannot change into or out of this stance during combat.
  • max_stacks:0
  • duration:-0.00
  • cooldown:1.50
  • default_chance:0.00%
greater_draenic_strength_flask

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_greater_draenic_strength_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:strength
  • amount:250.00

Stack Uptimes

  • greater_draenic_strength_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156080
  • name:Greater Draenic Strength Flask
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
resolve

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_resolve
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • resolve_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Custom Section

Dârkride

Overall DPS

22242.70

Percentage of damage dealt to primary target

%100.00

Dps done to primary target

22242.70

DPS occuring inside of shield charge + benefiting from shield charge

6845.39

Percentage of overall damage

30.78

Resources

Resource Usage Type Count Total Average RPE APR
Dârkride
execute Rage 6.5 193.8 30.0 30.0 1044.1
heroic_strike Rage 187.4 1946.9 10.4 10.4 626.1
shield_charge Rage 21.3 425.3 20.0 20.0 0.0
Resource Gains Type Count Total Average Overflow
blood_craze Health 51.12 0.00 (0.00%) 0.00 137175.07 100.00%
external_healing Health 8.16 0.00 (0.00%) 0.00 76842.60 100.00%
charge Rage 1.00 35.00 (1.35%) 35.00 0.00 0.00%
enrage Rage 44.94 448.12 (17.26%) 9.97 1.30 0.29%
revenge Rage 30.18 599.86 (23.10%) 19.88 3.76 0.62%
shield_slam Rage 66.90 1335.31 (51.42%) 19.96 2.59 0.19%
sword_and_board Rage 36.09 178.63 (6.88%) 4.95 1.84 1.02%
Resource RPS-Gain RPS-Loss
Rage 8.63 8.53
Combat End Resource Mean Min Max
Rage 31.29 0.00 100.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Rage Cap 0.7%

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Dârkride Fight Length
Count 25000
Mean 300.94
Minimum 230.43
Maximum 374.11
Spread ( max - min ) 143.68
Range [ ( max - min ) / 2 * 100% ] 23.87%
DPS
Sample Data Dârkride Damage Per Second
Count 25000
Mean 22242.70
Minimum 20010.14
Maximum 25038.05
Spread ( max - min ) 5027.91
Range [ ( max - min ) / 2 * 100% ] 11.30%
Standard Deviation 625.2629
5th Percentile 21262.13
95th Percentile 23312.49
( 95th Percentile - 5th Percentile ) 2050.37
Mean Distribution
Standard Deviation 3.9545
95.00% Confidence Intervall ( 22234.94 - 22250.45 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 30
0.1% Error 3035
0.1 Scale Factor Error with Delta=300 3337
0.05 Scale Factor Error with Delta=300 13349
0.01 Scale Factor Error with Delta=300 333740
Distribution Chart
DPS(e)
Sample Data Dârkride Damage Per Second (Effective)
Count 25000
Mean 22242.70
Minimum 20010.14
Maximum 25038.05
Spread ( max - min ) 5027.91
Range [ ( max - min ) / 2 * 100% ] 11.30%
Damage
Sample Data Dârkride Damage
Count 25000
Mean 6681170.52
Minimum 4934289.03
Maximum 8604481.60
Spread ( max - min ) 3670192.57
Range [ ( max - min ) / 2 * 100% ] 27.47%
DTPS
Sample Data Dârkride Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Dârkride Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Dârkride Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Dârkride Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Dârkride Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Dârkride Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data DârkrideTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Dârkride Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_strength_flask
1 0.00 food,type=blackrock_barbecue
2 0.00 stance,choose=gladiator
talent_override=bladestorm,if=raid_event.adds.count>1|desired_targets>2|(raid_event.adds.duration<10&raid_event.adds.exists) talent_override=dragon_roar,if=raid_event.adds.count>=1|desired_targets>1
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done. # Generic on-use trinket line if needed when swapping trinkets out. #actions+=/use_item,slot=trinket1,if=buff.bloodbath.up|buff.avatar.up|buff.shield_charge.up|target.time_to_die<10
4 0.00 potion,name=draenic_armor
Default action list Executed every time the actor is available.
# count action,conditions
5 1.00 charge
6 1.00 auto_attack
7 0.00 call_action_list,name=movement,if=movement.distance>5
This is mostly to prevent cooldowns from being accidentally used during movement.
8 0.00 avatar
9 5.53 bloodbath
A 0.00 blood_fury,if=buff.bloodbath.up|buff.avatar.up|buff.shield_charge.up|target.time_to_die<10
B 0.00 berserking,if=buff.bloodbath.up|buff.avatar.up|buff.shield_charge.up|target.time_to_die<10
C 0.00 arcane_torrent,if=rage<rage.max-40
D 1.00 potion,name=draenic_armor,if=buff.bloodbath.up|buff.avatar.up|buff.shield_charge.up
E 21.27 shield_charge,if=(!buff.shield_charge.up&!cooldown.shield_slam.remains)|charges=2
F 9.11 berserker_rage,if=buff.enrage.down
G 6.87 heroic_leap,if=(raid_event.movement.distance>25&raid_event.movement.in>45)|!raid_event.movement.exists
H 147.34 heroic_strike,if=(buff.shield_charge.up|(buff.unyielding_strikes.up&rage>=50-buff.unyielding_strikes.stack*5))&target.health.pct>20
I 40.02 heroic_strike,if=buff.ultimatum.up|rage>=rage.max-20|buff.unyielding_strikes.stack>4|target.time_to_die<10
J 0.00 call_action_list,name=single,if=active_enemies=1
K 0.00 call_action_list,name=aoe,if=active_enemies>=2
actions.single
# count action,conditions
P 19.62 devastate,if=buff.unyielding_strikes.stack>0&buff.unyielding_strikes.stack<6&buff.unyielding_strikes.remains<1.5
Q 66.90 shield_slam
R 30.18 revenge
S 0.00 execute,if=buff.sudden_death.react
T 0.00 storm_bolt
U 5.37 dragon_roar
V 6.46 execute,if=rage>60&target.health.pct<20
W 101.27 devastate

Sample Sequence

014569EFQHHRHUWWQHHWGWHHWEQHHRHWHWHQHWHWEHQHWWHQHRHWWQHHWHQHWHQHWHRHWEHQHWHQHWHQHWHWHRHQHWHQHWEHQHWHQHRHWGHWFHQHWQHHW9DRHHWEQHHUHPHQHWHRWHHQHWWWEQHHRHPHWHQHWHQWHHQHRFHPWEQHHWHQHWHRHWGHQHWHWIWEHQHRPHWQHWWIWIIQ9HRFHWWEHQHHUPHWQHRPHWHEHQHWHWHWHQRWHHWQHGWHWEQHFHRHPHWHQHWHWQRIWHWHEQHWQHHWQHHRHPHWHQHWHW9WHEQHRHPQHHUPWQFGHRHPHWEHQHWHQHWHRHWQWHWWIIQHRHPHWEHQHWHQHWRHFWQWHWWHEQHHRHPHWHQHWGIWW9EQIRIPVQIPUVPIIQFIRIPIVEIQIWWQRIPQIVPWEQIRPIIVIQIPIWIWGIQFRIIWIWEQIIWWIIWIQIR

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 0.0/100: 0% rage
Pre food Fluffy_Pillow 0.0/100: 0% rage
Pre potion Fluffy_Pillow 0.0/100: 0% rage draenic_armor_potion
0:00.000 charge Fluffy_Pillow 0.0/100: 0% rage draenic_armor_potion
0:00.000 auto_attack Fluffy_Pillow 35.0/100: 35% rage draenic_armor_potion
0:00.000 bloodbath Fluffy_Pillow 35.0/100: 35% rage spirit_of_the_warlords, draenic_armor_potion
0:00.000 shield_charge Fluffy_Pillow 35.0/100: 35% rage bloodbath, spirit_of_the_warlords, draenic_armor_potion
0:00.000 berserker_rage Fluffy_Pillow 15.0/100: 15% rage bloodbath, shield_charge, spirit_of_the_warlords, draenic_armor_potion
0:00.000 shield_slam Fluffy_Pillow 25.0/100: 25% rage berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, spirit_of_the_warlords, draenic_armor_potion
0:00.000 heroic_strike Fluffy_Pillow 55.0/100: 55% rage berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, spirit_of_the_warlords, draenic_armor_potion
0:01.363 heroic_strike Fluffy_Pillow 55.0/100: 55% rage bloodlust, berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, spirit_of_the_warlords, draenic_armor_potion
0:01.363 revenge Fluffy_Pillow 25.0/100: 25% rage bloodlust, berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, spirit_of_the_warlords, draenic_armor_potion
0:02.414 heroic_strike Fluffy_Pillow 45.0/100: 45% rage bloodlust, berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, spirit_of_the_warlords, draenic_armor_potion
0:02.414 dragon_roar Fluffy_Pillow 15.0/100: 15% rage bloodlust, berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, spirit_of_the_warlords, draenic_armor_potion
0:03.465 devastate Fluffy_Pillow 15.0/100: 15% rage bloodlust, berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, spirit_of_the_warlords, draenic_armor_potion
0:04.515 devastate Fluffy_Pillow 15.0/100: 15% rage bloodlust, berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes, spirit_of_the_warlords, draenic_armor_potion
0:05.567 shield_slam Fluffy_Pillow 15.0/100: 15% rage bloodlust, berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(2), spirit_of_the_warlords, draenic_armor_potion
0:05.567 heroic_strike Fluffy_Pillow 50.0/100: 50% rage bloodlust, berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(2), spirit_of_the_warlords, draenic_armor_potion
0:06.617 heroic_strike Fluffy_Pillow 50.0/100: 50% rage bloodlust, bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(2), spirit_of_the_warlords, draenic_armor_potion
0:06.617 devastate Fluffy_Pillow 30.0/100: 30% rage bloodlust, bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(2), spirit_of_the_warlords, draenic_armor_potion
0:07.667 heroic_leap Fluffy_Pillow 30.0/100: 30% rage bloodlust, bloodbath, enrage, enraged_speed, unyielding_strikes(3), spirit_of_the_warlords, draenic_armor_potion
0:07.667 devastate Fluffy_Pillow 30.0/100: 30% rage bloodlust, bloodbath, enrage, enraged_speed, unyielding_strikes(3), spirit_of_the_warlords, draenic_armor_potion
0:07.667 heroic_strike Fluffy_Pillow 30.0/100: 30% rage bloodlust, bloodbath, enrage, enraged_speed, unyielding_strikes(4), spirit_of_the_warlords, draenic_armor_potion
0:08.717 heroic_strike Fluffy_Pillow 30.0/100: 30% rage bloodlust, bloodbath, enrage, enraged_speed, unyielding_strikes(4), spirit_of_the_warlords, draenic_armor_potion
0:08.717 devastate Fluffy_Pillow 20.0/100: 20% rage bloodlust, bloodbath, enrage, enraged_speed, unyielding_strikes(4), spirit_of_the_warlords, draenic_armor_potion
0:08.717 shield_charge Fluffy_Pillow 0.0/100: 0% rage bloodlust, bloodbath, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(5), spirit_of_the_warlords, draenic_armor_potion
0:09.768 shield_slam Fluffy_Pillow 0.0/100: 0% rage bloodlust, bloodbath, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(5), spirit_of_the_warlords, draenic_armor_potion
0:09.768 heroic_strike Fluffy_Pillow 35.0/100: 35% rage bloodlust, bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(5), spirit_of_the_warlords, draenic_armor_potion
0:10.821 heroic_strike Fluffy_Pillow 35.0/100: 35% rage bloodlust, bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(5), spirit_of_the_warlords, draenic_armor_potion
0:10.821 revenge Fluffy_Pillow 30.0/100: 30% rage bloodlust, bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(5), spirit_of_the_warlords, draenic_armor_potion
0:11.873 heroic_strike Fluffy_Pillow 50.0/100: 50% rage bloodlust, bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(5), spirit_of_the_warlords, draenic_armor_potion
0:11.873 devastate Fluffy_Pillow 45.0/100: 45% rage bloodlust, bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(5), spirit_of_the_warlords, draenic_armor_potion
0:12.923 heroic_strike Fluffy_Pillow 45.0/100: 45% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(6), spirit_of_the_warlords, draenic_armor_potion
0:12.923 devastate Fluffy_Pillow 45.0/100: 45% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(6), spirit_of_the_warlords, draenic_armor_potion
0:13.974 heroic_strike Fluffy_Pillow 45.0/100: 45% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(6), spirit_of_the_warlords, draenic_armor_potion
0:13.974 shield_slam Fluffy_Pillow 45.0/100: 45% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(6), spirit_of_the_warlords, draenic_armor_potion
0:15.024 heroic_strike Fluffy_Pillow 65.0/100: 65% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(6), spirit_of_the_warlords, draenic_armor_potion
0:15.024 devastate Fluffy_Pillow 65.0/100: 65% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(6), spirit_of_the_warlords, draenic_armor_potion
0:16.073 heroic_strike Fluffy_Pillow 65.0/100: 65% rage bloodlust, enrage, enraged_speed, unyielding_strikes(6), spirit_of_the_warlords, draenic_armor_potion
0:16.073 devastate Fluffy_Pillow 65.0/100: 65% rage bloodlust, enrage, enraged_speed, unyielding_strikes(6), spirit_of_the_warlords, draenic_armor_potion
0:16.073 shield_charge Fluffy_Pillow 45.0/100: 45% rage bloodlust, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6), spirit_of_the_warlords, draenic_armor_potion
0:17.124 heroic_strike Fluffy_Pillow 45.0/100: 45% rage bloodlust, enrage, enraged_speed, shield_charge, sword_and_board, spirit_of_the_warlords, draenic_armor_potion
0:17.124 shield_slam Fluffy_Pillow 15.0/100: 15% rage bloodlust, enrage, enraged_speed, shield_charge, sword_and_board, spirit_of_the_warlords, draenic_armor_potion
0:18.175 heroic_strike Fluffy_Pillow 40.0/100: 40% rage bloodlust, shield_charge, spirit_of_the_warlords, draenic_armor_potion
0:18.175 devastate Fluffy_Pillow 10.0/100: 10% rage bloodlust, shield_charge, spirit_of_the_warlords, draenic_armor_potion
0:19.226 devastate Fluffy_Pillow 10.0/100: 10% rage bloodlust, shield_charge, unyielding_strikes, spirit_of_the_warlords, draenic_armor_potion
0:19.226 heroic_strike Fluffy_Pillow 0.0/100: 0% rage bloodlust, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(2), spirit_of_the_warlords, draenic_armor_potion
0:20.277 shield_slam Fluffy_Pillow 0.0/100: 0% rage bloodlust, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(2)
0:20.277 heroic_strike Fluffy_Pillow 5.0/100: 5% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
0:21.327 revenge Fluffy_Pillow 5.0/100: 5% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
0:21.327 heroic_strike Fluffy_Pillow 5.0/100: 5% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
0:22.377 devastate Fluffy_Pillow 5.0/100: 5% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
0:23.427 devastate Fluffy_Pillow 5.0/100: 5% rage bloodlust, enrage, enraged_speed, unyielding_strikes(3)
0:24.479 shield_slam Fluffy_Pillow 5.0/100: 5% rage bloodlust, enrage, enraged_speed, unyielding_strikes(4)
0:24.479 heroic_strike Fluffy_Pillow 35.0/100: 35% rage bloodlust, enrage, enraged_speed, unyielding_strikes(4)
0:25.528 heroic_strike Fluffy_Pillow 35.0/100: 35% rage bloodlust, enrage, enraged_speed, unyielding_strikes(4)
0:25.528 devastate Fluffy_Pillow 25.0/100: 25% rage bloodlust, enrage, enraged_speed, unyielding_strikes(4)
0:26.579 heroic_strike Fluffy_Pillow 35.0/100: 35% rage bloodlust, enrage, enraged_speed, sword_and_board, unyielding_strikes(5)
0:26.579 shield_slam Fluffy_Pillow 30.0/100: 30% rage bloodlust, enrage, enraged_speed, sword_and_board, unyielding_strikes(5)
0:27.630 heroic_strike Fluffy_Pillow 55.0/100: 55% rage bloodlust, blood_craze, enrage, enraged_speed, unyielding_strikes(5)
0:27.630 devastate Fluffy_Pillow 50.0/100: 50% rage bloodlust, blood_craze, enrage, enraged_speed, unyielding_strikes(5)
0:28.681 heroic_strike Fluffy_Pillow 50.0/100: 50% rage bloodlust, blood_craze, enrage, enraged_speed, sword_and_board, unyielding_strikes(6)
0:28.681 shield_slam Fluffy_Pillow 50.0/100: 50% rage bloodlust, blood_craze, enrage, enraged_speed, sword_and_board, unyielding_strikes(6)
0:29.731 heroic_strike Fluffy_Pillow 85.0/100: 85% rage bloodlust, blood_craze, enrage, enraged_speed, unyielding_strikes(6), ultimatum
0:29.731 devastate Fluffy_Pillow 85.0/100: 85% rage bloodlust, blood_craze, enrage, enraged_speed, unyielding_strikes(6)
0:30.780 heroic_strike Fluffy_Pillow 85.0/100: 85% rage bloodlust, enrage, enraged_speed, unyielding_strikes(6)
0:30.780 revenge Fluffy_Pillow 85.0/100: 85% rage bloodlust, enrage, enraged_speed, unyielding_strikes(6)
0:31.831 heroic_strike Fluffy_Pillow 100.0/100: 100% rage bloodlust, enrage, enraged_speed, unyielding_strikes(6)
0:31.831 devastate Fluffy_Pillow 100.0/100: 100% rage bloodlust, enrage, enraged_speed, unyielding_strikes(6)
0:32.882 shield_charge Fluffy_Pillow 100.0/100: 100% rage bloodlust, enrage, enraged_speed
0:32.882 heroic_strike Fluffy_Pillow 80.0/100: 80% rage bloodlust, enrage, enraged_speed, shield_charge
0:32.882 shield_slam Fluffy_Pillow 50.0/100: 50% rage bloodlust, enrage, enraged_speed, shield_charge
0:33.933 heroic_strike Fluffy_Pillow 80.0/100: 80% rage bloodlust, enrage, enraged_speed, shield_charge, ultimatum
0:33.933 devastate Fluffy_Pillow 80.0/100: 80% rage bloodlust, enrage, enraged_speed, shield_charge
0:34.984 heroic_strike Fluffy_Pillow 80.0/100: 80% rage bloodlust, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes
0:34.984 shield_slam Fluffy_Pillow 55.0/100: 55% rage bloodlust, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes
0:36.035 heroic_strike Fluffy_Pillow 80.0/100: 80% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes
0:36.035 devastate Fluffy_Pillow 55.0/100: 55% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes
0:37.086 heroic_strike Fluffy_Pillow 55.0/100: 55% rage bloodlust, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(2)
0:37.086 shield_slam Fluffy_Pillow 35.0/100: 35% rage bloodlust, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(2)
0:38.136 heroic_strike Fluffy_Pillow 60.0/100: 60% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
0:38.136 devastate Fluffy_Pillow 40.0/100: 40% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
0:39.189 heroic_strike Fluffy_Pillow 40.0/100: 40% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(3)
0:39.189 devastate Fluffy_Pillow 25.0/100: 25% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(3)
0:40.239 heroic_strike Fluffy_Pillow 35.0/100: 35% rage bloodlust, enrage, enraged_speed, unyielding_strikes(4)
0:40.239 revenge Fluffy_Pillow 25.0/100: 25% rage bloodlust, enrage, enraged_speed, unyielding_strikes(4)
0:41.289 heroic_strike Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, unyielding_strikes(4)
0:41.289 shield_slam Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, unyielding_strikes(4)
0:42.654 heroic_strike Fluffy_Pillow 55.0/100: 55% rage enrage, enraged_speed, unyielding_strikes(4)
0:42.654 devastate Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, unyielding_strikes(4)
0:44.018 heroic_strike Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, sword_and_board, unyielding_strikes(5)
0:44.018 shield_slam Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, sword_and_board, unyielding_strikes(5)
0:45.384 heroic_strike Fluffy_Pillow 65.0/100: 65% rage enrage, enraged_speed, unyielding_strikes(5)
0:45.384 devastate Fluffy_Pillow 60.0/100: 60% rage enrage, enraged_speed, unyielding_strikes(5)
0:45.384 shield_charge Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6)
0:46.748 heroic_strike Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6)
0:46.748 shield_slam Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6)
0:48.112 heroic_strike Fluffy_Pillow 75.0/100: 75% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6), ultimatum
0:48.112 devastate Fluffy_Pillow 75.0/100: 75% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6)
0:49.475 heroic_strike Fluffy_Pillow 75.0/100: 75% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6)
0:49.475 shield_slam Fluffy_Pillow 75.0/100: 75% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6)
0:50.840 heroic_strike Fluffy_Pillow 100.0/100: 100% rage enrage, enraged_speed, shield_charge
0:50.840 revenge Fluffy_Pillow 70.0/100: 70% rage enrage, enraged_speed, shield_charge
0:52.205 heroic_strike Fluffy_Pillow 90.0/100: 90% rage enrage, enraged_speed, shield_charge
0:52.205 devastate Fluffy_Pillow 60.0/100: 60% rage enrage, enraged_speed, shield_charge
0:53.569 heroic_leap Fluffy_Pillow 60.0/100: 60% rage enrage, enraged_speed, unyielding_strikes
0:53.569 heroic_strike Fluffy_Pillow 60.0/100: 60% rage enrage, enraged_speed, unyielding_strikes
0:53.569 devastate Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, unyielding_strikes
0:54.934 berserker_rage Fluffy_Pillow 35.0/100: 35% rage unyielding_strikes(2)
0:54.934 heroic_strike Fluffy_Pillow 45.0/100: 45% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(2)
0:54.934 shield_slam Fluffy_Pillow 25.0/100: 25% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(2)
0:56.299 heroic_strike Fluffy_Pillow 45.0/100: 45% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(2)
0:56.299 devastate Fluffy_Pillow 25.0/100: 25% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(2)
0:57.664 shield_slam Fluffy_Pillow 25.0/100: 25% rage berserker_rage, enrage, enraged_speed, sword_and_board, unyielding_strikes(3)
0:57.664 heroic_strike Fluffy_Pillow 35.0/100: 35% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(3)
0:59.029 heroic_strike Fluffy_Pillow 35.0/100: 35% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(3)
0:59.029 devastate Fluffy_Pillow 20.0/100: 20% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(3)
1:00.394 bloodbath Fluffy_Pillow 20.0/100: 20% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(4)
1:00.394 potion Fluffy_Pillow 20.0/100: 20% rage berserker_rage, bloodbath, enrage, enraged_speed, unyielding_strikes(4)
1:00.394 revenge Fluffy_Pillow 20.0/100: 20% rage berserker_rage, bloodbath, enrage, enraged_speed, unyielding_strikes(4), draenic_armor_potion
1:00.394 heroic_strike Fluffy_Pillow 30.0/100: 30% rage berserker_rage, bloodbath, enrage, enraged_speed, unyielding_strikes(4), draenic_armor_potion
1:01.759 heroic_strike Fluffy_Pillow 30.0/100: 30% rage bloodbath, enrage, enraged_speed, unyielding_strikes(4), draenic_armor_potion
1:01.759 devastate Fluffy_Pillow 20.0/100: 20% rage bloodbath, enrage, enraged_speed, unyielding_strikes(4), draenic_armor_potion
1:01.759 shield_charge Fluffy_Pillow 0.0/100: 0% rage bloodbath, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(5), draenic_armor_potion
1:03.124 shield_slam Fluffy_Pillow 0.0/100: 0% rage bloodbath, shield_charge, sword_and_board, unyielding_strikes(5), draenic_armor_potion
1:03.124 heroic_strike Fluffy_Pillow 35.0/100: 35% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(5), draenic_armor_potion
1:04.487 heroic_strike Fluffy_Pillow 35.0/100: 35% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(5), draenic_armor_potion
1:04.487 dragon_roar Fluffy_Pillow 30.0/100: 30% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(5), draenic_armor_potion
1:05.851 heroic_strike Fluffy_Pillow 30.0/100: 30% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(5), draenic_armor_potion
1:05.851 devastate Fluffy_Pillow 25.0/100: 25% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(5), draenic_armor_potion
1:07.216 heroic_strike Fluffy_Pillow 25.0/100: 25% rage bloodbath, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6), draenic_armor_potion
1:07.216 shield_slam Fluffy_Pillow 25.0/100: 25% rage bloodbath, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6), draenic_armor_potion
1:08.579 heroic_strike Fluffy_Pillow 50.0/100: 50% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(6), draenic_armor_potion
1:08.579 devastate Fluffy_Pillow 50.0/100: 50% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(6), draenic_armor_potion
1:09.945 heroic_strike Fluffy_Pillow 50.0/100: 50% rage bloodbath, enrage, enraged_speed, unyielding_strikes(6), draenic_armor_potion
1:09.945 revenge Fluffy_Pillow 50.0/100: 50% rage bloodbath, enrage, enraged_speed, unyielding_strikes(6), draenic_armor_potion
1:11.311 devastate Fluffy_Pillow 70.0/100: 70% rage bloodbath, draenic_armor_potion
1:11.311 heroic_strike Fluffy_Pillow 55.0/100: 55% rage bloodbath, enrage, enraged_speed, unyielding_strikes, draenic_armor_potion
1:12.675 heroic_strike Fluffy_Pillow 55.0/100: 55% rage enrage, enraged_speed, unyielding_strikes, draenic_armor_potion
1:12.675 shield_slam Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, unyielding_strikes, draenic_armor_potion
1:14.039 heroic_strike Fluffy_Pillow 50.0/100: 50% rage enrage, enraged_speed, unyielding_strikes, draenic_armor_potion
1:14.039 devastate Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, unyielding_strikes, draenic_armor_potion
1:15.403 devastate Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, unyielding_strikes(2), draenic_armor_potion
1:16.768 devastate Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, unyielding_strikes(3), draenic_armor_potion
1:18.133 shield_charge Fluffy_Pillow 25.0/100: 25% rage blood_craze, enrage, enraged_speed, unyielding_strikes(4), draenic_armor_potion
1:18.133 shield_slam Fluffy_Pillow 5.0/100: 5% rage blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(4), draenic_armor_potion
1:18.133 heroic_strike Fluffy_Pillow 15.0/100: 15% rage blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(4), draenic_armor_potion
1:19.498 heroic_strike Fluffy_Pillow 15.0/100: 15% rage blood_craze, shield_charge, unyielding_strikes(4), draenic_armor_potion
1:19.498 revenge Fluffy_Pillow 5.0/100: 5% rage blood_craze, shield_charge, unyielding_strikes(4), draenic_armor_potion
1:20.863 heroic_strike Fluffy_Pillow 25.0/100: 25% rage shield_charge, unyielding_strikes(4), draenic_armor_potion
1:20.863 devastate Fluffy_Pillow 15.0/100: 15% rage shield_charge, unyielding_strikes(4), draenic_armor_potion
1:22.228 heroic_strike Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5), draenic_armor_potion
1:22.228 devastate Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5), draenic_armor_potion
1:23.591 heroic_strike Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6), draenic_armor_potion
1:23.591 shield_slam Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6), draenic_armor_potion
1:24.956 heroic_strike Fluffy_Pillow 50.0/100: 50% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6), ultimatum, draenic_armor_potion
1:24.956 devastate Fluffy_Pillow 50.0/100: 50% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6), draenic_armor_potion
1:26.321 heroic_strike Fluffy_Pillow 50.0/100: 50% rage enrage, enraged_speed, sword_and_board, unyielding_strikes(6)
1:26.321 shield_slam Fluffy_Pillow 50.0/100: 50% rage enrage, enraged_speed, sword_and_board, unyielding_strikes(6)
1:27.686 devastate Fluffy_Pillow 75.0/100: 75% rage blood_craze, enrage, enraged_speed
1:27.686 heroic_strike Fluffy_Pillow 50.0/100: 50% rage blood_craze, enrage, enraged_speed, sword_and_board, unyielding_strikes
1:29.051 heroic_strike Fluffy_Pillow 50.0/100: 50% rage blood_craze, enrage, enraged_speed, sword_and_board, unyielding_strikes
1:29.051 shield_slam Fluffy_Pillow 25.0/100: 25% rage blood_craze, enrage, enraged_speed, sword_and_board, unyielding_strikes
1:30.416 heroic_strike Fluffy_Pillow 50.0/100: 50% rage enrage, enraged_speed, unyielding_strikes
1:30.416 revenge Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, unyielding_strikes
1:31.781 berserker_rage Fluffy_Pillow 45.0/100: 45% rage unyielding_strikes
1:31.781 heroic_strike Fluffy_Pillow 55.0/100: 55% rage berserker_rage, enrage, enraged_speed, unyielding_strikes
1:31.781 devastate Fluffy_Pillow 30.0/100: 30% rage berserker_rage, enrage, enraged_speed, unyielding_strikes
1:33.146 devastate Fluffy_Pillow 30.0/100: 30% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(2)
1:34.511 shield_charge Fluffy_Pillow 30.0/100: 30% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(3)
1:34.511 shield_slam Fluffy_Pillow 10.0/100: 10% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(3)
1:34.511 heroic_strike Fluffy_Pillow 40.0/100: 40% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(3)
1:35.876 heroic_strike Fluffy_Pillow 40.0/100: 40% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(3)
1:35.876 devastate Fluffy_Pillow 25.0/100: 25% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(3)
1:37.241 heroic_strike Fluffy_Pillow 25.0/100: 25% rage berserker_rage, blood_craze, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(4)
1:37.241 shield_slam Fluffy_Pillow 15.0/100: 15% rage berserker_rage, blood_craze, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(4)
1:38.605 heroic_strike Fluffy_Pillow 40.0/100: 40% rage blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(4)
1:38.605 devastate Fluffy_Pillow 30.0/100: 30% rage blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(4)
1:39.969 heroic_strike Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5)
1:39.969 revenge Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5)
1:41.334 heroic_strike Fluffy_Pillow 55.0/100: 55% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5)
1:41.334 devastate Fluffy_Pillow 50.0/100: 50% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5)
1:42.700 heroic_leap Fluffy_Pillow 50.0/100: 50% rage enrage, enraged_speed, unyielding_strikes(6)
1:42.700 heroic_strike Fluffy_Pillow 50.0/100: 50% rage enrage, enraged_speed, unyielding_strikes(6)
1:42.700 shield_slam Fluffy_Pillow 50.0/100: 50% rage enrage, enraged_speed, unyielding_strikes(6)
1:44.066 heroic_strike Fluffy_Pillow 70.0/100: 70% rage enrage, enraged_speed, unyielding_strikes(6)
1:44.066 devastate Fluffy_Pillow 70.0/100: 70% rage enrage, enraged_speed, unyielding_strikes(6)
1:45.430 heroic_strike Fluffy_Pillow 70.0/100: 70% rage enrage, enraged_speed, unyielding_strikes(6)
1:45.430 devastate Fluffy_Pillow 70.0/100: 70% rage enrage, enraged_speed, unyielding_strikes(6)
1:46.794 heroic_strike Fluffy_Pillow 80.0/100: 80% rage enrage, enraged_speed
1:46.794 devastate Fluffy_Pillow 50.0/100: 50% rage enrage, enraged_speed
1:48.155 shield_charge Fluffy_Pillow 50.0/100: 50% rage enrage, enraged_speed, unyielding_strikes
1:48.155 heroic_strike Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, shield_charge, unyielding_strikes
1:48.155 shield_slam Fluffy_Pillow 5.0/100: 5% rage enrage, enraged_speed, shield_charge, unyielding_strikes
1:49.520 heroic_strike Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, shield_charge, unyielding_strikes
1:49.520 revenge Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, shield_charge, unyielding_strikes
1:50.885 devastate Fluffy_Pillow 20.0/100: 20% rage blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes
1:50.885 heroic_strike Fluffy_Pillow 0.0/100: 0% rage blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
1:52.252 devastate Fluffy_Pillow 0.0/100: 0% rage blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
1:53.617 shield_slam Fluffy_Pillow 0.0/100: 0% rage shield_charge, unyielding_strikes(3)
1:53.617 heroic_strike Fluffy_Pillow 5.0/100: 5% rage shield_charge, unyielding_strikes(3)
1:54.981 devastate Fluffy_Pillow 5.0/100: 5% rage shield_charge, unyielding_strikes(3)
1:56.346 devastate Fluffy_Pillow 5.0/100: 5% rage unyielding_strikes(4)
1:56.346 heroic_strike Fluffy_Pillow 0.0/100: 0% rage unyielding_strikes(5), spirit_of_the_warlords
1:57.711 devastate Fluffy_Pillow 0.0/100: 0% rage unyielding_strikes(5), spirit_of_the_warlords
1:57.711 heroic_strike Fluffy_Pillow 0.0/100: 0% rage unyielding_strikes(6), spirit_of_the_warlords
1:59.075 heroic_strike Fluffy_Pillow 0.0/100: 0% rage unyielding_strikes(6), spirit_of_the_warlords
1:59.075 shield_slam Fluffy_Pillow 0.0/100: 0% rage unyielding_strikes(6), spirit_of_the_warlords
2:00.440 bloodbath Fluffy_Pillow 20.0/100: 20% rage blood_craze, unyielding_strikes(6), spirit_of_the_warlords
2:00.440 heroic_strike Fluffy_Pillow 20.0/100: 20% rage bloodbath, blood_craze, unyielding_strikes(6), spirit_of_the_warlords
2:00.440 revenge Fluffy_Pillow 20.0/100: 20% rage bloodbath, blood_craze, unyielding_strikes(6), spirit_of_the_warlords
2:01.804 berserker_rage Fluffy_Pillow 40.0/100: 40% rage bloodbath, blood_craze, unyielding_strikes(6), spirit_of_the_warlords
2:01.804 heroic_strike Fluffy_Pillow 50.0/100: 50% rage berserker_rage, bloodbath, blood_craze, enrage, enraged_speed, unyielding_strikes(6), spirit_of_the_warlords
2:01.804 devastate Fluffy_Pillow 50.0/100: 50% rage berserker_rage, bloodbath, blood_craze, enrage, enraged_speed, unyielding_strikes(6), spirit_of_the_warlords
2:03.169 devastate Fluffy_Pillow 50.0/100: 50% rage berserker_rage, bloodbath, enrage, enraged_speed, spirit_of_the_warlords
2:03.169 shield_charge Fluffy_Pillow 30.0/100: 30% rage berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes, spirit_of_the_warlords
2:03.169 heroic_strike Fluffy_Pillow 5.0/100: 5% rage berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes, spirit_of_the_warlords
2:04.534 shield_slam Fluffy_Pillow 5.0/100: 5% rage berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes, spirit_of_the_warlords
2:04.534 heroic_strike Fluffy_Pillow 40.0/100: 40% rage berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes, spirit_of_the_warlords
2:05.899 heroic_strike Fluffy_Pillow 40.0/100: 40% rage berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes, spirit_of_the_warlords
2:05.899 dragon_roar Fluffy_Pillow 15.0/100: 15% rage berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes, spirit_of_the_warlords
2:07.266 devastate Fluffy_Pillow 15.0/100: 15% rage berserker_rage, bloodbath, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes, spirit_of_the_warlords
2:07.266 heroic_strike Fluffy_Pillow 5.0/100: 5% rage berserker_rage, bloodbath, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(2), spirit_of_the_warlords
2:08.633 devastate Fluffy_Pillow 5.0/100: 5% rage bloodbath, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(2), spirit_of_the_warlords
2:09.998 shield_slam Fluffy_Pillow 5.0/100: 5% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(3), spirit_of_the_warlords
2:09.998 heroic_strike Fluffy_Pillow 10.0/100: 10% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(3), spirit_of_the_warlords
2:11.363 revenge Fluffy_Pillow 10.0/100: 10% rage bloodbath, enrage, enraged_speed, unyielding_strikes(3), spirit_of_the_warlords
2:12.728 devastate Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, unyielding_strikes(3), spirit_of_the_warlords
2:12.728 heroic_strike Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, unyielding_strikes(4), spirit_of_the_warlords
2:14.091 devastate Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, unyielding_strikes(4), spirit_of_the_warlords
2:14.091 heroic_strike Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, sword_and_board, unyielding_strikes(5), spirit_of_the_warlords
2:15.091 shield_charge Fluffy_Pillow 5.0/100: 5% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(5), spirit_of_the_warlords
2:15.457 heroic_strike Fluffy_Pillow 5.0/100: 5% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(5), spirit_of_the_warlords
2:15.457 shield_slam Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(5), spirit_of_the_warlords
2:16.823 heroic_strike Fluffy_Pillow 35.0/100: 35% rage blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(5), ultimatum
2:16.823 devastate Fluffy_Pillow 35.0/100: 35% rage blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(5)
2:18.189 heroic_strike Fluffy_Pillow 35.0/100: 35% rage blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(6)
2:18.189 devastate Fluffy_Pillow 35.0/100: 35% rage blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(6)
2:19.553 heroic_strike Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6)
2:19.553 devastate Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6)
2:20.918 heroic_strike Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6)
2:20.918 shield_slam Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6)
2:22.281 revenge Fluffy_Pillow 55.0/100: 55% rage enrage, enraged_speed
2:23.648 devastate Fluffy_Pillow 75.0/100: 75% rage blood_craze
2:23.648 heroic_strike Fluffy_Pillow 60.0/100: 60% rage blood_craze, enrage, enraged_speed, unyielding_strikes
2:25.013 heroic_strike Fluffy_Pillow 60.0/100: 60% rage blood_craze, enrage, enraged_speed, unyielding_strikes
2:25.013 devastate Fluffy_Pillow 35.0/100: 35% rage blood_craze, enrage, enraged_speed, unyielding_strikes
2:26.375 shield_slam Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, unyielding_strikes(2)
2:26.375 heroic_strike Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, unyielding_strikes(2)
2:27.740 heroic_leap Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, unyielding_strikes(2)
2:27.740 devastate Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, unyielding_strikes(2)
2:27.740 heroic_strike Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, unyielding_strikes(3)
2:29.104 devastate Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, unyielding_strikes(3)
2:30.004 shield_charge Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(4)
2:30.470 shield_slam Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(4)
2:30.470 heroic_strike Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, shield_charge, unyielding_strikes(4)
2:31.836 berserker_rage Fluffy_Pillow 15.0/100: 15% rage shield_charge, unyielding_strikes(4)
2:31.836 heroic_strike Fluffy_Pillow 25.0/100: 25% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(4)
2:31.836 revenge Fluffy_Pillow 15.0/100: 15% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(4)
2:33.200 heroic_strike Fluffy_Pillow 35.0/100: 35% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(4)
2:33.200 devastate Fluffy_Pillow 25.0/100: 25% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(4)
2:34.565 heroic_strike Fluffy_Pillow 25.0/100: 25% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(5)
2:34.565 devastate Fluffy_Pillow 20.0/100: 20% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(5)
2:35.929 heroic_strike Fluffy_Pillow 20.0/100: 20% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(6)
2:35.929 shield_slam Fluffy_Pillow 20.0/100: 20% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(6)
2:37.293 heroic_strike Fluffy_Pillow 40.0/100: 40% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(6)
2:37.293 devastate Fluffy_Pillow 40.0/100: 40% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(6)
2:38.657 heroic_strike Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, unyielding_strikes(6)
2:38.657 devastate Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, unyielding_strikes(6)
2:40.021 shield_slam Fluffy_Pillow 40.0/100: 40% rage sword_and_board
2:41.386 revenge Fluffy_Pillow 65.0/100: 65% rage
2:41.386 heroic_strike Fluffy_Pillow 55.0/100: 55% rage
2:42.752 devastate Fluffy_Pillow 55.0/100: 55% rage
2:42.752 heroic_strike Fluffy_Pillow 30.0/100: 30% rage unyielding_strikes
2:44.116 devastate Fluffy_Pillow 30.0/100: 30% rage unyielding_strikes
2:44.116 heroic_strike Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, sword_and_board, unyielding_strikes(2)
2:45.016 shield_charge Fluffy_Pillow 0.0/100: 0% rage blood_craze, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(2)
2:45.479 shield_slam Fluffy_Pillow 0.0/100: 0% rage blood_craze, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(2)
2:45.479 heroic_strike Fluffy_Pillow 5.0/100: 5% rage blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
2:46.845 devastate Fluffy_Pillow 5.0/100: 5% rage blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
2:48.208 shield_slam Fluffy_Pillow 5.0/100: 5% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(3)
2:48.208 heroic_strike Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, shield_charge, unyielding_strikes(3)
2:49.573 heroic_strike Fluffy_Pillow 15.0/100: 15% rage blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(3)
2:49.573 devastate Fluffy_Pillow 0.0/100: 0% rage blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(3)
2:50.936 shield_slam Fluffy_Pillow 0.0/100: 0% rage blood_craze, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(4)
2:50.936 heroic_strike Fluffy_Pillow 35.0/100: 35% rage blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(4)
2:52.301 heroic_strike Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, unyielding_strikes(4)
2:52.301 revenge Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, unyielding_strikes(4)
2:53.666 heroic_strike Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, unyielding_strikes(4)
2:53.666 devastate Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, unyielding_strikes(4)
2:55.029 heroic_strike Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, unyielding_strikes(5)
2:55.029 devastate Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, unyielding_strikes(5)
2:56.395 heroic_strike Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, unyielding_strikes(6)
2:56.395 shield_slam Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, unyielding_strikes(6)
2:57.761 heroic_strike Fluffy_Pillow 50.0/100: 50% rage enrage, enraged_speed, unyielding_strikes(6)
2:57.761 devastate Fluffy_Pillow 50.0/100: 50% rage enrage, enraged_speed, unyielding_strikes(6)
2:59.126 heroic_strike Fluffy_Pillow 50.0/100: 50% rage unyielding_strikes(6)
2:59.126 devastate Fluffy_Pillow 50.0/100: 50% rage unyielding_strikes(6)
3:00.490 bloodbath Fluffy_Pillow 50.0/100: 50% rage
3:00.490 devastate Fluffy_Pillow 50.0/100: 50% rage bloodbath
3:00.490 heroic_strike Fluffy_Pillow 35.0/100: 35% rage bloodbath, enrage, enraged_speed, unyielding_strikes
3:01.856 shield_charge Fluffy_Pillow 35.0/100: 35% rage bloodbath, enrage, enraged_speed, unyielding_strikes
3:01.856 shield_slam Fluffy_Pillow 15.0/100: 15% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes
3:01.856 heroic_strike Fluffy_Pillow 10.0/100: 10% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes
3:03.220 revenge Fluffy_Pillow 10.0/100: 10% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes
3:03.220 heroic_strike Fluffy_Pillow 5.0/100: 5% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes
3:04.586 devastate Fluffy_Pillow 5.0/100: 5% rage bloodbath, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes
3:05.950 shield_slam Fluffy_Pillow 15.0/100: 15% rage bloodbath, blood_craze, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(2)
3:05.950 heroic_strike Fluffy_Pillow 20.0/100: 20% rage bloodbath, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
3:07.315 heroic_strike Fluffy_Pillow 20.0/100: 20% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
3:07.315 dragon_roar Fluffy_Pillow 0.0/100: 0% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
3:08.681 devastate Fluffy_Pillow 0.0/100: 0% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
3:10.046 devastate Fluffy_Pillow 0.0/100: 0% rage bloodbath, enrage, enraged_speed, unyielding_strikes(3)
3:11.410 shield_slam Fluffy_Pillow 0.0/100: 0% rage bloodbath, enrage, enraged_speed, sword_and_board, unyielding_strikes(4)
3:12.774 berserker_rage Fluffy_Pillow 25.0/100: 25% rage unyielding_strikes(4)
3:12.774 heroic_leap Fluffy_Pillow 35.0/100: 35% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(4)
3:12.774 heroic_strike Fluffy_Pillow 35.0/100: 35% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(4)
3:12.774 revenge Fluffy_Pillow 25.0/100: 25% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(4)
3:14.139 heroic_strike Fluffy_Pillow 45.0/100: 45% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(4)
3:14.139 devastate Fluffy_Pillow 35.0/100: 35% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(4)
3:15.503 heroic_strike Fluffy_Pillow 45.0/100: 45% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(5)
3:15.503 devastate Fluffy_Pillow 40.0/100: 40% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(5)
3:16.869 shield_charge Fluffy_Pillow 50.0/100: 50% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(6)
3:16.869 heroic_strike Fluffy_Pillow 30.0/100: 30% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(6)
3:16.869 shield_slam Fluffy_Pillow 30.0/100: 30% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(6)
3:18.234 heroic_strike Fluffy_Pillow 50.0/100: 50% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(6)
3:18.234 devastate Fluffy_Pillow 50.0/100: 50% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(6)
3:19.599 heroic_strike Fluffy_Pillow 50.0/100: 50% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6)
3:19.599 shield_slam Fluffy_Pillow 50.0/100: 50% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6)
3:20.965 heroic_strike Fluffy_Pillow 75.0/100: 75% rage enrage, enraged_speed, shield_charge
3:20.965 devastate Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, shield_charge
3:22.330 heroic_strike Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, shield_charge, unyielding_strikes
3:22.330 revenge Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, shield_charge, unyielding_strikes
3:23.694 heroic_strike Fluffy_Pillow 40.0/100: 40% rage shield_charge, unyielding_strikes
3:23.694 devastate Fluffy_Pillow 15.0/100: 15% rage shield_charge, unyielding_strikes
3:25.059 shield_slam Fluffy_Pillow 15.0/100: 15% rage unyielding_strikes(2)
3:26.423 devastate Fluffy_Pillow 35.0/100: 35% rage unyielding_strikes(2)
3:26.423 heroic_strike Fluffy_Pillow 20.0/100: 20% rage unyielding_strikes(3)
3:27.788 devastate Fluffy_Pillow 20.0/100: 20% rage unyielding_strikes(3)
3:29.153 devastate Fluffy_Pillow 20.0/100: 20% rage unyielding_strikes(4)
3:29.153 heroic_strike Fluffy_Pillow 15.0/100: 15% rage unyielding_strikes(5)
3:30.519 heroic_strike Fluffy_Pillow 15.0/100: 15% rage blood_craze, unyielding_strikes(5)
3:30.519 shield_slam Fluffy_Pillow 10.0/100: 10% rage blood_craze, unyielding_strikes(5)
3:31.883 heroic_strike Fluffy_Pillow 30.0/100: 30% rage blood_craze, unyielding_strikes(5)
3:31.883 revenge Fluffy_Pillow 25.0/100: 25% rage blood_craze, unyielding_strikes(5)
3:33.246 heroic_strike Fluffy_Pillow 45.0/100: 45% rage unyielding_strikes(5)
3:33.246 devastate Fluffy_Pillow 40.0/100: 40% rage unyielding_strikes(5)
3:34.610 heroic_strike Fluffy_Pillow 40.0/100: 40% rage unyielding_strikes(6)
3:34.610 devastate Fluffy_Pillow 40.0/100: 40% rage unyielding_strikes(6)
3:35.974 shield_charge Fluffy_Pillow 40.0/100: 40% rage unyielding_strikes(6)
3:35.974 heroic_strike Fluffy_Pillow 20.0/100: 20% rage shield_charge, unyielding_strikes(6)
3:35.974 shield_slam Fluffy_Pillow 20.0/100: 20% rage shield_charge, unyielding_strikes(6)
3:37.339 heroic_strike Fluffy_Pillow 40.0/100: 40% rage blood_craze, shield_charge, unyielding_strikes(6)
3:37.339 devastate Fluffy_Pillow 40.0/100: 40% rage blood_craze, shield_charge, unyielding_strikes(6)
3:38.704 heroic_strike Fluffy_Pillow 40.0/100: 40% rage blood_craze, shield_charge, sword_and_board
3:38.704 shield_slam Fluffy_Pillow 10.0/100: 10% rage blood_craze, shield_charge, sword_and_board
3:40.069 heroic_strike Fluffy_Pillow 35.0/100: 35% rage shield_charge
3:40.069 devastate Fluffy_Pillow 5.0/100: 5% rage shield_charge
3:41.434 revenge Fluffy_Pillow 5.0/100: 5% rage shield_charge, unyielding_strikes
3:41.434 heroic_strike Fluffy_Pillow 0.0/100: 0% rage shield_charge, unyielding_strikes
3:42.797 berserker_rage Fluffy_Pillow 0.0/100: 0% rage shield_charge, unyielding_strikes
3:42.797 devastate Fluffy_Pillow 10.0/100: 10% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes
3:44.162 shield_slam Fluffy_Pillow 10.0/100: 10% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(2)
3:45.527 devastate Fluffy_Pillow 30.0/100: 30% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(2)
3:45.527 heroic_strike Fluffy_Pillow 25.0/100: 25% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(3)
3:46.891 devastate Fluffy_Pillow 25.0/100: 25% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(3)
3:48.256 devastate Fluffy_Pillow 25.0/100: 25% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(4)
3:48.256 heroic_strike Fluffy_Pillow 20.0/100: 20% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(5)
3:49.621 shield_charge Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, unyielding_strikes(5)
3:49.621 shield_slam Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5)
3:49.621 heroic_strike Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5)
3:50.986 heroic_strike Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5)
3:50.986 revenge Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5)
3:52.350 heroic_strike Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5)
3:52.350 devastate Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5)
3:53.713 heroic_strike Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6)
3:53.713 devastate Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6), spirit_of_the_warlords
3:55.077 heroic_strike Fluffy_Pillow 50.0/100: 50% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6), spirit_of_the_warlords
3:55.077 shield_slam Fluffy_Pillow 50.0/100: 50% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6), spirit_of_the_warlords
3:56.442 heroic_strike Fluffy_Pillow 80.0/100: 80% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6), ultimatum, spirit_of_the_warlords
3:56.442 devastate Fluffy_Pillow 80.0/100: 80% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6), spirit_of_the_warlords
3:57.806 heroic_leap Fluffy_Pillow 90.0/100: 90% rage enrage, enraged_speed, spirit_of_the_warlords
3:57.806 heroic_strike Fluffy_Pillow 90.0/100: 90% rage enrage, enraged_speed, spirit_of_the_warlords
3:57.806 devastate Fluffy_Pillow 60.0/100: 60% rage enrage, enraged_speed, spirit_of_the_warlords
3:59.170 devastate Fluffy_Pillow 60.0/100: 60% rage enrage, enraged_speed, unyielding_strikes, spirit_of_the_warlords
4:00.534 bloodbath Fluffy_Pillow 60.0/100: 60% rage enrage, enraged_speed, unyielding_strikes(2), spirit_of_the_warlords
4:00.534 shield_charge Fluffy_Pillow 60.0/100: 60% rage bloodbath, enrage, enraged_speed, unyielding_strikes(2), spirit_of_the_warlords
4:00.534 shield_slam Fluffy_Pillow 40.0/100: 40% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(2), spirit_of_the_warlords
4:00.534 heroic_strike Fluffy_Pillow 70.0/100: 70% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(2), spirit_of_the_warlords
4:01.898 revenge Fluffy_Pillow 70.0/100: 70% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(2), spirit_of_the_warlords
4:01.898 heroic_strike Fluffy_Pillow 70.0/100: 70% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(2), spirit_of_the_warlords
4:03.261 devastate Fluffy_Pillow 70.0/100: 70% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(2), spirit_of_the_warlords
4:04.626 execute Fluffy_Pillow 70.0/100: 70% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(3), spirit_of_the_warlords
4:05.992 shield_slam Fluffy_Pillow 40.0/100: 40% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(3), spirit_of_the_warlords
4:05.992 heroic_strike Fluffy_Pillow 70.0/100: 70% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(3), spirit_of_the_warlords
4:07.356 devastate Fluffy_Pillow 70.0/100: 70% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(3), spirit_of_the_warlords
4:08.721 dragon_roar Fluffy_Pillow 70.0/100: 70% rage bloodbath, enrage, enraged_speed, unyielding_strikes(4), spirit_of_the_warlords
4:10.085 execute Fluffy_Pillow 70.0/100: 70% rage bloodbath, enrage, enraged_speed, unyielding_strikes(4), spirit_of_the_warlords
4:11.449 devastate Fluffy_Pillow 40.0/100: 40% rage bloodbath, enrage, enraged_speed, unyielding_strikes(4), spirit_of_the_warlords
4:11.449 heroic_strike Fluffy_Pillow 35.0/100: 35% rage bloodbath, enrage, enraged_speed, sword_and_board, unyielding_strikes(5), spirit_of_the_warlords
4:12.815 heroic_strike Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, sword_and_board, unyielding_strikes(5), spirit_of_the_warlords
4:12.815 shield_slam Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, sword_and_board, unyielding_strikes(5), spirit_of_the_warlords
4:14.179 berserker_rage Fluffy_Pillow 55.0/100: 55% rage unyielding_strikes(5)
4:14.179 heroic_strike Fluffy_Pillow 65.0/100: 65% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(5)
4:14.179 revenge Fluffy_Pillow 60.0/100: 60% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(5)
4:15.544 heroic_strike Fluffy_Pillow 80.0/100: 80% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(5)
4:15.544 devastate Fluffy_Pillow 75.0/100: 75% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(5)
4:16.906 heroic_strike Fluffy_Pillow 75.0/100: 75% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(6)
4:16.906 execute Fluffy_Pillow 75.0/100: 75% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(6)
4:18.272 shield_charge Fluffy_Pillow 45.0/100: 45% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(6)
4:18.272 heroic_strike Fluffy_Pillow 25.0/100: 25% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(6)
4:18.272 shield_slam Fluffy_Pillow 25.0/100: 25% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(6)
4:19.635 heroic_strike Fluffy_Pillow 45.0/100: 45% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(6)
4:19.635 devastate Fluffy_Pillow 45.0/100: 45% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(6)
4:20.999 devastate Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, shield_charge
4:22.364 shield_slam Fluffy_Pillow 45.0/100: 45% rage shield_charge, sword_and_board, unyielding_strikes
4:23.726 revenge Fluffy_Pillow 70.0/100: 70% rage shield_charge, unyielding_strikes
4:23.726 heroic_strike Fluffy_Pillow 65.0/100: 65% rage shield_charge, unyielding_strikes
4:25.091 devastate Fluffy_Pillow 65.0/100: 65% rage shield_charge, unyielding_strikes
4:26.455 shield_slam Fluffy_Pillow 65.0/100: 65% rage sword_and_board, unyielding_strikes(2)
4:26.455 heroic_strike Fluffy_Pillow 70.0/100: 70% rage unyielding_strikes(2)
4:27.820 execute Fluffy_Pillow 70.0/100: 70% rage unyielding_strikes(2)
4:29.185 devastate Fluffy_Pillow 40.0/100: 40% rage unyielding_strikes(2)
4:30.550 devastate Fluffy_Pillow 40.0/100: 40% rage unyielding_strikes(3)
4:30.550 shield_charge Fluffy_Pillow 20.0/100: 20% rage shield_charge, sword_and_board, unyielding_strikes(4)
4:31.916 shield_slam Fluffy_Pillow 20.0/100: 20% rage shield_charge, sword_and_board, unyielding_strikes(4)
4:31.916 heroic_strike Fluffy_Pillow 55.0/100: 55% rage enrage, enraged_speed, shield_charge, unyielding_strikes(4)
4:33.280 revenge Fluffy_Pillow 55.0/100: 55% rage enrage, enraged_speed, shield_charge, unyielding_strikes(4)
4:34.645 devastate Fluffy_Pillow 75.0/100: 75% rage enrage, enraged_speed, shield_charge, unyielding_strikes(4)
4:34.645 heroic_strike Fluffy_Pillow 70.0/100: 70% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5)
4:36.010 heroic_strike Fluffy_Pillow 70.0/100: 70% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5)
4:36.010 execute Fluffy_Pillow 65.0/100: 65% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5)
4:37.374 heroic_strike Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5)
4:37.374 shield_slam Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5)
4:38.738 heroic_strike Fluffy_Pillow 50.0/100: 50% rage blood_craze, enrage, enraged_speed, unyielding_strikes(5)
4:38.738 devastate Fluffy_Pillow 45.0/100: 45% rage blood_craze, enrage, enraged_speed, unyielding_strikes(5)
4:40.104 heroic_strike Fluffy_Pillow 45.0/100: 45% rage blood_craze, unyielding_strikes(6)
4:40.104 devastate Fluffy_Pillow 45.0/100: 45% rage blood_craze, unyielding_strikes(6)
4:41.469 heroic_strike Fluffy_Pillow 45.0/100: 45% rage unyielding_strikes(6)
4:41.469 devastate Fluffy_Pillow 45.0/100: 45% rage unyielding_strikes(6)
4:42.835 heroic_leap Fluffy_Pillow 45.0/100: 45% rage unyielding_strikes(6)
4:42.835 heroic_strike Fluffy_Pillow 45.0/100: 45% rage unyielding_strikes(6)
4:42.835 shield_slam Fluffy_Pillow 45.0/100: 45% rage unyielding_strikes(6)
4:44.198 berserker_rage Fluffy_Pillow 65.0/100: 65% rage
4:44.198 revenge Fluffy_Pillow 75.0/100: 75% rage berserker_rage, enrage, enraged_speed
4:44.198 heroic_strike Fluffy_Pillow 65.0/100: 65% rage berserker_rage, enrage, enraged_speed
4:45.563 heroic_strike Fluffy_Pillow 65.0/100: 65% rage berserker_rage, enrage, enraged_speed
4:45.563 devastate Fluffy_Pillow 35.0/100: 35% rage berserker_rage, enrage, enraged_speed
4:46.928 heroic_strike Fluffy_Pillow 35.0/100: 35% rage berserker_rage, enrage, enraged_speed, unyielding_strikes
4:46.928 devastate Fluffy_Pillow 10.0/100: 10% rage berserker_rage, enrage, enraged_speed, unyielding_strikes
4:48.294 shield_charge Fluffy_Pillow 20.0/100: 20% rage berserker_rage, blood_craze, enrage, enraged_speed, unyielding_strikes(2)
4:48.294 shield_slam Fluffy_Pillow 0.0/100: 0% rage berserker_rage, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
4:48.294 heroic_strike Fluffy_Pillow 30.0/100: 30% rage berserker_rage, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
4:49.659 heroic_strike Fluffy_Pillow 30.0/100: 30% rage berserker_rage, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
4:49.659 devastate Fluffy_Pillow 10.0/100: 10% rage berserker_rage, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
4:51.024 devastate Fluffy_Pillow 10.0/100: 10% rage blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(3)
4:51.024 heroic_strike Fluffy_Pillow 10.0/100: 10% rage blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(4)
4:52.389 heroic_strike Fluffy_Pillow 10.0/100: 10% rage blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(4)
4:52.389 devastate Fluffy_Pillow 0.0/100: 0% rage blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(4)
4:53.750 heroic_strike Fluffy_Pillow 10.0/100: 10% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(5)
4:53.750 shield_slam Fluffy_Pillow 5.0/100: 5% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(5)
4:55.113 heroic_strike Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5)
4:55.113 revenge Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4129 3683 3683 (1596)
Agility 933 889 889
Stamina 4312 3920 3778
Intellect 746 711 711
Spirit 679 679 679
Health 258720 235200 0
Rage 100 100 0
Crit 19.49% 13.58% 944
Haste 10.23% 4.98% 498
Multistrike 6.68% 1.68% 111
Damage / Heal Versatility 7.83% 4.83% 628
Attack Power 5508 4351 0
Mastery 30.10% 22.24% 751
Armor 2781 2781 2675
Bonus Armor 106 106 106

Talents

Level
15 Juggernaut Double Time Warbringer
30 Enraged Regeneration Second Wind Impending Victory
45 Heavy Repercussions (Protection Warrior) Sudden Death Unyielding Strikes (Protection Warrior)
60 Storm Bolt Shockwave Dragon Roar
75 Mass Spell Reflection Safeguard Vigilance
90 Avatar Bloodbath Bladestorm
100 Anger Management Ravager Gladiator's Resolve (Protection Warrior)

Profile

warrior="Dârkride"
origin="http://eu.battle.net/wow/en/character/forscherliga/Dârkride/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/237/36647661-avatar.jpg"
level=100
race=human
role=attack
position=back
professions=blacksmithing=666/mining=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Zb!1022212
glyphs=enraged_speed/cleave/bull_rush/gushing_wound/bloodcurdling_shout/mystic_shout
spec=protection

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_strength_flask
actions.precombat+=/food,type=blackrock_barbecue
#
talent_override=bladestorm,if=raid_event.adds.count>1|desired_targets>2|(raid_event.adds.duration<10&raid_event.adds.exists)
talent_override=dragon_roar,if=raid_event.adds.count>=1|desired_targets>1
actions.precombat+=/stance,choose=gladiator
# Snapshot raid buffed stats before combat begins and pre-potting is done.
# Generic on-use trinket line if needed when swapping trinkets out.
#actions+=/use_item,slot=trinket1,if=buff.bloodbath.up|buff.avatar.up|buff.shield_charge.up|target.time_to_die<10
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=draenic_armor

# Executed every time the actor is available.

actions=charge
actions+=/auto_attack
# This is mostly to prevent cooldowns from being accidentally used during movement.
actions+=/call_action_list,name=movement,if=movement.distance>5
actions+=/avatar
actions+=/bloodbath
actions+=/blood_fury,if=buff.bloodbath.up|buff.avatar.up|buff.shield_charge.up|target.time_to_die<10
actions+=/berserking,if=buff.bloodbath.up|buff.avatar.up|buff.shield_charge.up|target.time_to_die<10
actions+=/arcane_torrent,if=rage<rage.max-40
actions+=/potion,name=draenic_armor,if=buff.bloodbath.up|buff.avatar.up|buff.shield_charge.up
actions+=/shield_charge,if=(!buff.shield_charge.up&!cooldown.shield_slam.remains)|charges=2
actions+=/berserker_rage,if=buff.enrage.down
actions+=/heroic_leap,if=(raid_event.movement.distance>25&raid_event.movement.in>45)|!raid_event.movement.exists
actions+=/heroic_strike,if=(buff.shield_charge.up|(buff.unyielding_strikes.up&rage>=50-buff.unyielding_strikes.stack*5))&target.health.pct>20
actions+=/heroic_strike,if=buff.ultimatum.up|rage>=rage.max-20|buff.unyielding_strikes.stack>4|target.time_to_die<10
actions+=/call_action_list,name=single,if=active_enemies=1
actions+=/call_action_list,name=aoe,if=active_enemies>=2

actions.movement=heroic_leap
actions.movement+=/shield_charge
# May as well throw storm bolt if we can.
actions.movement+=/storm_bolt
actions.movement+=/heroic_throw

actions.single=devastate,if=buff.unyielding_strikes.stack>0&buff.unyielding_strikes.stack<6&buff.unyielding_strikes.remains<1.5
actions.single+=/shield_slam
actions.single+=/revenge
actions.single+=/execute,if=buff.sudden_death.react
actions.single+=/storm_bolt
actions.single+=/dragon_roar
actions.single+=/execute,if=rage>60&target.health.pct<20
actions.single+=/devastate

actions.aoe=revenge
actions.aoe+=/shield_slam
actions.aoe+=/dragon_roar,if=(buff.bloodbath.up|cooldown.bloodbath.remains>10)|!talent.bloodbath.enabled
actions.aoe+=/storm_bolt,if=(buff.bloodbath.up|cooldown.bloodbath.remains>7)|!talent.bloodbath.enabled
actions.aoe+=/thunder_clap,cycle_targets=1,if=dot.deep_wounds.remains<3&active_enemies>4
actions.aoe+=/bladestorm,if=buff.shield_charge.down
actions.aoe+=/execute,if=buff.sudden_death.react
actions.aoe+=/thunder_clap,if=active_enemies>6
actions.aoe+=/devastate,cycle_targets=1,if=dot.deep_wounds.remains<5&cooldown.shield_slam.remains>execute_time*0.4
actions.aoe+=/devastate,if=cooldown.shield_slam.remains>execute_time*0.4

head=casque_of_the_iron_bomber,id=113600
neck=flesh_beetle_brooch,id=109968,bonus_id=524,enchant=40crit
shoulders=verdant_plate_spaulders,id=109944,bonus_id=524
back=milenahs_intricate_cloak,id=119345,enchant=100crit
chest=gutcrusher_chestplate,id=109895,bonus_id=499/523/524,gems=35crit
shirt=antisepticsoaked_dressing,id=44694
wrists=verdant_plate_wristguards,id=109877,bonus_id=523/524,gems=35crit
hands=gauntlets_of_the_heavy_hand,id=113632,bonus_id=563,gems=35crit
waist=ripswallow_plate_belt,id=119337,bonus_id=560
legs=truesteel_greaves,id=114234,bonus_id=94/525/533
feet=entrail_squishers,id=113633
finger1=timeless_solium_band_of_the_bulwark,id=118298
finger2=knucklebone_of_lodronar,id=109772,bonus_id=524,enchant=30mastery
trinket1=mote_of_corruption,id=110010,bonus_id=524
trinket2=skull_of_war,id=112318,bonus_id=525/529
main_hand=tharbeks_brutal_posessor,id=118726,bonus_id=524,enchant=mark_of_the_shattered_hand
off_hand=ogre_dinner_plate,id=110044,bonus_id=524

# Gear Summary
# gear_strength=2228
# gear_stamina=2844
# gear_crit_rating=944
# gear_haste_rating=498
# gear_mastery_rating=715
# gear_armor=2675
# gear_bonus_armor=106
# gear_multistrike_rating=111
# gear_versatility_rating=528

Simulation & Raid Information

Iterations: 25004
Threads: 4
Confidence: 95.00%
Fight Length: 230 - 374 ( 300.9 )

Performance:

Total Events Processed: 1253804515
Max Event Queue: 416
Sim Seconds: 7524583
CPU Seconds: 547.0680
Physical Seconds: 547.0680
Speed Up: 13754

Settings:

World Lag: 50 ms ( stddev = 5 ms )
Queue Lag: 5 ms ( stddev = 1 ms )
Simulation Length
Sample Data Simulation Length
Count 25000
Mean 300.94
Minimum 230.43
Maximum 374.11
Spread ( max - min ) 143.68
Range [ ( max - min ) / 2 * 100% ] 23.87%
Standard Deviation 39.3184
5th Percentile 242.00
95th Percentile 363.04
( 95th Percentile - 5th Percentile ) 121.04
Mean Distribution
Standard Deviation 0.2487
95.00% Confidence Intervall ( 300.45 - 301.42 )
Normalized 95.00% Confidence Intervall ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 655
0.1% Error 65575
0.1 Scale Factor Error with Delta=300 13
0.05 Scale Factor Error with Delta=300 52
0.01 Scale Factor Error with Delta=300 1319
Distribution Chart
Timeline Distribution Chart Gear Chart Raid Downtime Chart
DPET Chart DPET Chart DPET Chart DPET Chart

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
Ciaran Ciaran celestial_alignment 112071 0 0 0.40 0 0 2.0 2.0 13.2% 0.0% 0.0% 0.0% 181.76sec 0 300.94sec
Ciaran Ciaran draenic_intellect_potion 156426 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.94sec
Ciaran Ciaran force_of_nature 33831 0 0 3.35 0 0 16.8 16.8 12.6% 0.0% 0.0% 0.0% 19.74sec 0 300.94sec
Ciaran Ciaran moonfire 8921 51538 171 1.80 4806 9118 9.0 9.0 12.8% 0.0% 0.0% 0.0% 34.97sec 760316 300.94sec
Ciaran Ciaran moonfire ticks -8921 708779 2363 35.14 3330 6763 9.0 175.7 12.9% 0.0% 0.0% 0.0% 34.97sec 760316 300.94sec
Ciaran Ciaran moonkin_form 24858 0 0 0.20 0 0 1.0 1.0 10.7% 0.0% 0.0% 0.0% 0.00sec 0 300.94sec
Ciaran Ciaran shattered_bleed 159238 33974 113 3.47 1617 3250 17.4 17.4 12.8% 0.0% 0.0% 0.0% 17.53sec 115549 300.94sec
Ciaran Ciaran shattered_bleed ticks -159238 81575 272 19.46 784 0 17.4 97.3 0.0% 0.0% 0.0% 0.0% 17.53sec 115549 300.94sec
Ciaran Ciaran starfire 2912 2033890 6759 10.49 31792 65195 52.6 52.6 13.1% 0.0% 0.0% 0.0% 5.61sec 2033890 300.94sec
Ciaran Ciaran starsurge 78674 1188399 3949 6.09 31998 65474 30.7 30.6 13.1% 0.0% 0.0% 0.0% 10.02sec 1188399 300.94sec
Ciaran Ciaran sunfire 93402 81023 269 1.90 7039 14285 9.5 9.5 12.5% 0.0% 0.0% 0.0% 32.33sec 706934 300.94sec
Ciaran Ciaran sunfire ticks -93402 625911 2086 33.85 3051 6227 9.5 169.3 12.9% 0.0% 0.0% 0.0% 32.33sec 706934 300.94sec
Ciaran Ciaran wrath 5176 1235960 4107 12.24 16777 33583 61.7 61.4 12.3% 0.0% 0.0% 0.0% 4.26sec 1235960 300.94sec
Ciaran Ciaran yseras_gift ticks -145108 38451 128 8.74 880 0 0.0 43.7 0.0% 0.0% 0.0% 0.0% 0.00sec 427180 300.94sec
Ciaran Ciaran_treant wrath 113769 44574 206 28.29 362 728 102.3 101.9 12.8% 0.0% 0.0% 0.0% 3.13sec 44574 216.00sec
Kernoris Kernoris berserk 106952 0 0 0.40 0 0 2.0 2.0 28.4% 0.0% 0.0% 0.0% 183.31sec 0 300.94sec
Kernoris Kernoris cat_form 768 0 0 0.20 0 0 1.0 1.0 28.2% 0.0% 0.0% 0.0% 0.00sec 0 300.94sec
Kernoris Kernoris cat_melee 0 1618336 5378 70.84 3349 6697 355.3 355.3 28.4% 0.0% 0.0% 0.0% 0.85sec 2487128 300.94sec
Kernoris Kernoris draenic_agility_potion 156423 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.94sec
Kernoris Kernoris ferocious_bite 22568 1067556 3547 2.78 46131 92211 14.0 14.0 56.6% 0.0% 0.0% 0.0% 21.77sec 1640664 300.94sec
Kernoris Kernoris healing_touch 5185 0 0 5.79 0 0 29.0 29.0 31.3% 0.0% 0.0% 0.0% 10.57sec 970658 300.94sec
Kernoris Kernoris leader_of_the_pack 68285 0 0 7.86 0 0 39.4 39.4 0.0% 0.0% 0.0% 0.0% 7.70sec 332966 300.94sec
Kernoris Kernoris rake 1822 203085 675 4.64 6418 12856 23.2 23.2 28.4% 0.0% 0.0% 0.0% 13.04sec 1085302 300.94sec
Kernoris Kernoris rake ticks -1822 882217 2941 19.80 6544 13089 23.2 99.0 28.3% 0.0% 0.0% 0.0% 13.04sec 1085302 300.94sec
Kernoris Kernoris rip ticks -1079 1286933 4290 28.58 6622 13243 9.4 142.9 28.4% 0.0% 0.0% 0.0% 25.03sec 1286933 300.94sec
Kernoris Kernoris savage_roar 52610 0 0 1.53 0 0 7.7 7.7 0.0% 0.0% 0.0% 0.0% 37.59sec 0 300.94sec
Kernoris Kernoris shred 5221 1289385 4285 19.67 9609 19221 98.7 98.7 28.3% 0.0% 0.0% 0.0% 3.05sec 1981581 300.94sec
Kernoris Kernoris skull_bash 106839 0 0 1.68 0 0 8.4 8.4 0.0% 0.0% 0.0% 0.0% 37.56sec 0 300.94sec
Kernoris Kernoris thrash_cat 106830 15581 52 0.49 4683 9370 2.4 2.4 28.1% 0.0% 0.0% 0.0% 62.01sec 70539 300.94sec
Kernoris Kernoris thrash_cat ticks -106830 54957 183 2.41 3347 6694 2.4 12.1 28.4% 0.0% 0.0% 0.0% 62.01sec 70539 300.94sec
Kernoris Kernoris tigers_fury 5217 0 0 2.04 0 0 10.2 10.2 28.3% 0.0% 0.0% 0.0% 30.54sec 0 300.94sec
Kernoris Kernoris yseras_gift ticks -145108 37345 124 9.58 780 0 0.0 47.9 0.0% 0.0% 0.0% 0.0% 0.00sec 457176 300.94sec
Mekkasus Mekkasus a_murder_of_crows 131894 0 0 1.07 0 0 5.4 5.4 0.0% 0.0% 0.0% 0.0% 61.32sec 0 300.94sec
Mekkasus Mekkasus crow_peck 131900 615405 2045 15.68 5494 11290 0.0 78.6 30.0% 0.0% 0.0% 0.0% 0.00sec 945780 300.94sec
Mekkasus Mekkasus arcane_shot 3044 496652 1650 12.01 5885 12149 60.4 60.2 27.7% 0.0% 0.0% 0.0% 4.91sec 496652 300.94sec
Mekkasus Mekkasus auto_shot 0 554280 1842 25.75 3093 6359 129.2 129.2 26.7% 0.0% 0.0% 0.0% 2.34sec 851842 300.94sec
Mekkasus Mekkasus bestial_wrath 19574 0 0 1.05 0 0 5.3 5.3 0.0% 0.0% 0.0% 0.0% 62.75sec 0 300.94sec
Mekkasus Mekkasus cobra_shot 77767 387743 1288 17.17 3261 6682 86.4 86.1 26.3% 0.0% 0.0% 0.0% 3.34sec 387743 300.94sec
Mekkasus Mekkasus dire_beast 120679 0 0 2.05 0 0 10.3 10.3 0.0% 0.0% 0.0% 0.0% 30.71sec 0 300.94sec
Mekkasus Mekkasus_dire_beast_1 dire_beast_melee 0 381180 2669 40.27 2882 5802 95.9 95.9 27.1% 0.0% 0.0% 0.0% 3.13sec 585813 142.82sec
Mekkasus Mekkasus draenic_agility_potion 156423 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.94sec
Mekkasus Mekkasus focus_fire 82692 0 0 1.45 0 0 7.3 7.3 0.0% 0.0% 0.0% 0.0% 38.72sec 0 300.94sec
Mekkasus Mekkasus glaive_toss 117050 0 0 0.00 0 0 18.9 0.0 0.0% 0.0% 0.0% 0.0% 16.14sec 0 300.94sec
Mekkasus Mekkasus glaive_1 0 137487 457 3.72 5308 10894 0.0 18.7 26.8% 0.0% 0.0% 0.0% 0.00sec 211296 300.94sec
Mekkasus Mekkasus glaive_2 0 137596 457 3.72 5307 10903 0.0 18.7 26.8% 0.0% 0.0% 0.0% 0.00sec 211463 300.94sec
Mekkasus Mekkasus kill_command 34026 0 0 8.49 0 0 42.6 42.6 0.0% 0.0% 0.0% 0.0% 7.09sec 0 300.94sec
Mekkasus Mekkasus_cat kill_command 83381 797414 2650 8.49 12591 25414 42.6 42.6 36.7% 0.0% 0.0% 0.0% 7.09sec 1225499 300.94sec
Mekkasus Mekkasus kill_shot 53351 607148 2018 3.77 23260 47736 19.0 18.9 26.2% 0.0% 0.0% 0.0% 5.77sec 933091 300.94sec
Mekkasus Mekkasus summon_pet 0 0 0 0.20 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.94sec
Mekkasus Mekkasus_cat claw 16827 564898 1877 19.68 3614 7391 98.7 98.7 44.3% 0.0% 0.0% 0.0% 3.07sec 868159 300.94sec
Mekkasus Mekkasus_cat melee 0 892830 2967 45.62 2624 5295 228.8 228.8 36.7% 0.0% 0.0% 0.0% 1.31sec 1372138 300.94sec
Rapáx Rapáx a_murder_of_crows 131894 0 0 1.05 0 0 5.3 5.3 0.0% 0.0% 0.0% 0.0% 62.18sec 0 300.94sec
Rapáx Rapáx crow_peck 131900 461652 1534 15.44 4110 8254 0.0 77.4 33.6% 0.0% 0.0% 0.0% 0.00sec 709487 300.94sec
Rapáx Rapáx arcane_shot 3044 494214 1642 8.48 7914 15852 42.8 42.5 33.3% 0.0% 0.0% 0.0% 7.05sec 494214 300.94sec
Rapáx Rapáx auto_shot 0 578645 1923 21.14 3718 7450 106.0 106.0 33.3% 0.0% 0.0% 0.0% 2.85sec 889286 300.94sec
Rapáx Rapáx barrage ticks -120360 692972 2310 37.26 2426 4857 11.6 186.3 33.1% 0.0% 0.0% 0.0% 25.44sec 1015095 300.94sec
Rapáx Rapáx black_arrow ticks -3674 791866 2640 24.13 4472 8959 12.5 120.7 33.2% 0.0% 0.0% 0.0% 25.02sec 791866 300.94sec
Rapáx Rapáx cobra_shot 77767 542116 1801 15.66 4711 9433 78.7 78.5 33.1% 0.0% 0.0% 0.0% 3.75sec 542116 300.94sec
Rapáx Rapáx draenic_agility_potion 156423 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.94sec
Rapáx Rapáx exotic_munitions 162534 0 0 0.20 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.94sec
Rapáx Rapáx explosive_shot 53301 364604 1212 14.76 3354 6722 74.3 74.0 33.2% 0.0% 0.0% 0.0% 4.05sec 1447271 300.94sec
Rapáx Rapáx explosive_shot ticks -53301 1082667 3609 33.48 4408 8823 74.3 167.4 33.3% 0.0% 0.0% 0.0% 4.05sec 1447271 300.94sec
Rapáx Rapáx poisoned_ammo ticks -170661 245572 819 29.98 1231 2453 106.0 149.9 33.3% 0.0% 0.0% 0.0% 2.85sec 245572 300.94sec
Rapáx Rapáx serpent_sting ticks -118253 896548 2988 28.08 4352 8715 42.5 140.4 33.1% 0.0% 0.0% 0.0% 7.07sec 896548 300.94sec
Rapáx Rapáx summon_pet 0 0 0 0.20 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.94sec
Rapáx Rapáx_cat claw 16827 221841 737 14.55 1948 3928 73.0 73.0 43.3% 0.0% 0.0% 0.0% 4.17sec 340934 300.94sec
Rapáx Rapáx_cat melee 0 538284 1789 39.18 1763 3532 196.5 196.5 43.2% 0.0% 0.0% 0.0% 1.53sec 827258 300.94sec
Rosalîîe Rosalîîe a_murder_of_crows 131894 0 0 1.05 0 0 5.3 5.3 0.0% 0.0% 0.0% 0.0% 62.13sec 0 300.94sec
Rosalîîe Rosalîîe crow_peck 131900 509103 1692 15.45 4456 8912 0.0 77.5 29.0% 0.0% 0.0% 0.0% 0.00sec 782411 300.94sec
Rosalîîe Rosalîîe arcane_shot 3044 414399 1377 4.85 11348 22699 24.5 24.3 29.0% 0.0% 0.0% 0.0% 12.46sec 414399 300.94sec
Rosalîîe Rosalîîe auto_shot 0 823651 2737 20.83 5260 10521 104.5 104.5 29.0% 0.0% 0.0% 0.0% 2.89sec 1265821 300.94sec
Rosalîîe Rosalîîe barrage ticks -120360 868172 2894 41.23 2641 5282 12.9 206.1 29.0% 0.0% 0.0% 0.0% 23.14sec 1244253 300.94sec
Rosalîîe Rosalîîe black_arrow ticks -3674 1142995 3810 24.22 6298 12595 12.5 121.1 29.0% 0.0% 0.0% 0.0% 24.91sec 1142995 300.94sec
Rosalîîe Rosalîîe cobra_shot 77767 821294 2729 16.18 6776 13553 81.4 81.1 29.0% 0.0% 0.0% 0.0% 3.62sec 821294 300.94sec
Rosalîîe Rosalîîe dire_beast 120679 0 0 1.98 0 0 9.9 9.9 0.0% 0.0% 0.0% 0.0% 31.66sec 0 300.94sec
Rosalîîe Rosalîîe_dire_beast_1 dire_beast_melee 0 295992 2159 36.18 2435 4871 82.7 82.7 29.0% 0.0% 0.0% 0.0% 3.57sec 454893 137.10sec
Rosalîîe Rosalîîe draenic_agility_potion 156423 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.94sec
Rosalîîe Rosalîîe explosive_shot 53301 525724 1747 14.79 4725 9450 74.4 74.2 29.0% 0.0% 0.0% 0.0% 4.04sec 2086699 300.94sec
Rosalîîe Rosalîîe explosive_shot ticks -53301 1560975 5203 33.59 6205 12409 74.4 167.9 29.0% 0.0% 0.0% 0.0% 4.04sec 2086699 300.94sec
Rosalîîe Rosalîîe serpent_sting ticks -118253 847359 2825 24.11 4691 9378 24.3 120.6 29.0% 0.0% 0.0% 0.0% 12.52sec 847359 300.94sec
Procrank Procrank counterspell 2139 0 0 1.43 0 0 7.2 7.2 0.0% 0.0% 0.0% 0.0% 43.27sec 0 300.94sec
Procrank Procrank draenic_intellect_potion 156426 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.94sec
Procrank Procrank frostbolt 116 1462442 4860 19.60 9956 20044 98.5 98.3 14.9% 0.0% 0.0% 0.0% 3.03sec 1462442 300.94sec
Procrank Procrank icicle_fb 148022 665213 2210 38.06 3485 0 192.1 190.9 0.0% 0.0% 0.0% 0.0% 1.95sec 665213 300.94sec
Procrank Procrank frostfire_bolt 44614 1305568 4338 6.68 16756 33814 33.6 33.5 73.0% 0.0% 0.0% 0.0% 8.71sec 1305568 300.94sec
Procrank Procrank icicle_ffb 148022 525214 1745 13.72 7630 0 69.2 68.8 0.0% 0.0% 0.0% 0.0% 4.51sec 525214 300.94sec
Procrank Procrank frozen_orb 84714 0 0 1.08 0 0 5.4 5.4 0.0% 0.0% 0.0% 0.0% 61.08sec 0 300.94sec
Procrank Procrank frozen_orb_bolt 84721 286737 953 10.61 3364 6716 0.0 53.2 18.0% 0.0% 0.0% 0.0% 0.00sec 286737 300.94sec
Procrank Procrank ice_lance 30455 1538646 5113 9.73 13592 27344 49.0 48.8 74.0% 0.0% 0.0% 0.0% 6.10sec 1538646 300.94sec
Procrank Procrank ice_nova 157997 730053 2426 2.68 34576 69397 13.4 13.4 15.5% 0.0% 0.0% 0.0% 23.09sec 730053 300.94sec
Procrank Procrank icy_veins 12472 0 0 0.41 0 0 2.1 2.1 14.0% 0.0% 0.0% 0.0% 181.29sec 0 300.94sec
Procrank Procrank mirror_image 55342 0 0 0.60 0 0 3.0 3.0 15.8% 0.0% 0.0% 0.0% 120.86sec 0 300.94sec
Procrank Procrank_mirror_image frostbolt 59638 1173988 10507 105.21 3729 7548 196.9 195.9 19.0% 0.0% 0.0% 0.0% 4.16sec 1173988 111.73sec
Procrank Procrank water_elemental 31687 0 0 0.20 0 0 1.0 1.0 12.9% 0.0% 0.0% 0.0% 0.00sec 0 300.94sec
Procrank Procrank_water_elemental water_jet ticks -135029 152166 507 7.94 2525 5095 10.0 39.7 16.0% 0.0% 0.0% 0.0% 30.36sec 152166 300.94sec
Procrank Procrank_water_elemental waterbolt 31707 726980 2416 22.18 4301 8658 112.2 111.2 15.2% 0.0% 0.0% 0.0% 2.67sec 726980 300.94sec
Zentimeter Zentimeter counterspell 2139 0 0 1.43 0 0 7.2 7.2 0.0% 0.0% 0.0% 0.0% 43.22sec 0 300.94sec
Zentimeter Zentimeter draenic_intellect_potion 156426 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.94sec
Zentimeter Zentimeter frostbolt 116 1275776 4239 20.43 8819 17795 102.7 102.5 12.4% 0.0% 0.0% 0.0% 2.90sec 1275776 300.94sec
Zentimeter Zentimeter icicle_fb 148022 588285 1955 36.62 3203 0 184.8 183.7 0.0% 0.0% 0.0% 0.0% 1.96sec 588285 300.94sec
Zentimeter Zentimeter frostfire_bolt 44614 1024133 3403 6.22 14881 30063 31.2 31.2 69.4% 0.0% 0.0% 0.0% 9.39sec 1024133 300.94sec
Zentimeter Zentimeter icicle_ffb 148022 430608 1431 11.91 7207 0 60.0 59.7 0.0% 0.0% 0.0% 0.0% 5.14sec 430608 300.94sec
Zentimeter Zentimeter frozen_orb 84714 0 0 1.08 0 0 5.4 5.4 0.0% 0.0% 0.0% 0.0% 61.07sec 0 300.94sec
Zentimeter Zentimeter frozen_orb_bolt 84721 242182 805 10.62 2999 5986 0.0 53.2 15.5% 0.0% 0.0% 0.0% 0.00sec 242182 300.94sec
Zentimeter Zentimeter ice_lance 30455 1303177 4330 9.81 12077 24291 49.4 49.2 70.1% 0.0% 0.0% 0.0% 6.05sec 1303177 300.94sec
Zentimeter Zentimeter ice_nova 157997 615447 2045 2.68 30761 61858 13.4 13.4 13.0% 0.0% 0.0% 0.0% 23.09sec 615447 300.94sec
Zentimeter Zentimeter icy_veins 12472 0 0 0.41 0 0 2.1 2.1 11.3% 0.0% 0.0% 0.0% 181.22sec 0 300.94sec
Zentimeter Zentimeter mirror_image 55342 0 0 0.60 0 0 3.0 3.0 13.1% 0.0% 0.0% 0.0% 120.73sec 0 300.94sec
Zentimeter Zentimeter_mirror_image frostbolt 59638 1014467 9079 107.90 3315 6739 201.9 200.9 16.5% 0.0% 0.0% 0.0% 4.06sec 1014467 111.74sec
Zentimeter Zentimeter water_elemental 31687 0 0 0.20 0 0 1.0 1.0 10.4% 0.0% 0.0% 0.0% 0.00sec 0 300.94sec
Zentimeter Zentimeter_water_elemental water_jet ticks -135029 129043 430 7.94 2266 4581 10.0 39.7 13.5% 0.0% 0.0% 0.0% 30.38sec 129043 300.94sec
Zentimeter Zentimeter_water_elemental waterbolt 31707 628857 2090 22.65 3854 7776 114.5 113.6 12.7% 0.0% 0.0% 0.0% 2.62sec 628857 300.94sec
Zambo Zambo ardent_defender 31850 28 0 0.40 14 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 0.00sec 43 300.94sec
Zambo Zambo avengers_shield 31935 516525 1716 7.39 11486 23074 37.1 37.1 14.3% 0.0% 0.0% 0.0% 8.13sec 516525 300.94sec
Zambo Zambo consecration ticks -26573 367141 1224 42.97 1411 2832 24.3 214.8 14.1% 0.0% 0.0% 0.0% 11.42sec 367141 300.94sec
Zambo Zambo crusader_strike 35395 403158 1340 15.87 4181 8397 79.6 79.6 14.1% 0.0% 0.0% 7.5% 3.80sec 633855 300.94sec
Zambo Zambo divine_protection 498 0 0 2.10 0 0 10.5 10.5 0.0% 0.0% 0.0% 0.0% 30.02sec 0 300.94sec
Zambo Zambo draenic_armor_potion 156430 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.94sec
Zambo Zambo guardian_of_ancient_kings 86659 0 0 0.40 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 181.02sec 0 300.94sec
Zambo Zambo hammer_of_wrath 24275 91954 306 1.16 13121 26244 5.8 5.8 13.7% 0.0% 0.0% 0.0% 10.16sec 91954 300.94sec
Zambo Zambo holy_shield 157122 422175 1403 16.50 5103 0 82.8 82.7 0.0% 0.0% 0.0% 0.0% 3.62sec 422175 300.94sec
Zambo Zambo holy_shield_absorb 0 475774 1581 6.31 15022 0 0.0 31.7 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.94sec
Zambo Zambo holy_wrath 119072 284920 947 3.25 14464 29004 16.3 16.3 13.9% 0.0% 0.0% 0.0% 18.41sec 284920 300.94sec
Zambo Zambo judgment 20271 564418 1876 10.64 8720 17550 53.4 53.4 14.1% 0.0% 0.0% 0.0% 5.66sec 564418 300.94sec
Zambo Zambo lights_hammer 114158 0 0 1.02 0 0 5.1 5.1 0.0% 0.0% 0.0% 0.0% 64.05sec 0 300.94sec
Zambo Zambo lights_hammer_heal_tick 114919 918076 3051 47.81 3092 6083 0.0 239.8 17.4% 0.0% 0.0% 0.0% 0.00sec 2636720 300.94sec
Zambo Zambo lights_hammer_damage_tick 114919 302166 1004 7.97 6216 12551 40.0 40.0 14.4% 0.0% 0.0% 0.0% 7.05sec 302166 300.94sec
Zambo Zambo melee 0 652473 2168 28.84 3719 7467 144.6 144.6 14.2% 0.0% 0.0% 7.5% 2.07sec 1025799 300.94sec
Zambo Zambo sacred_shield 20925 0 0 3.26 0 0 16.4 16.4 0.0% 0.0% 0.0% 0.0% 18.78sec 0 300.94sec
Zambo Zambo sacred_shield_tick 65148 2063362 6856 14.13 29105 0 0.0 70.9 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.94sec
Zambo Zambo seal_of_insight_proc 20165 2116586 7033 52.04 6528 12971 261.0 261.0 17.3% 0.0% 0.0% 0.0% 1.22sec 2152977 300.94sec
Zambo Zambo shattered_bleed 159238 34299 114 3.51 1603 3207 17.6 17.6 14.5% 0.0% 0.0% 0.0% 17.38sec 116539 300.94sec
Zambo Zambo shattered_bleed ticks -159238 82240 274 19.57 792 0 17.6 97.8 0.0% 0.0% 0.0% 0.0% 17.38sec 116539 300.94sec
Zambo Zambo shield_of_the_righteous 53600 1266750 4209 14.19 14675 29417 71.2 71.2 14.2% 0.0% 0.0% 7.5% 4.15sec 1266750 300.94sec
Zambo Zambo shining_protector 159374 93922 312 7.81 2397 0 39.2 39.2 0.0% 0.0% 0.0% 0.0% 7.72sec 96644 300.94sec
Ðepeche Ðepeche avenging_wrath 31884 0 0 0.60 0 0 3.0 3.0 19.8% 0.0% 0.0% 0.0% 121.09sec 0 300.94sec
Ðepeche Ðepeche censure ticks -31803 216869 723 19.88 1761 3672 303.5 99.4 14.9% 0.0% 0.0% 0.0% 0.99sec 216869 300.94sec
Ðepeche Ðepeche crusader_strike 35395 508763 1691 12.63 6524 13506 63.3 63.3 14.4% 0.0% 0.0% 0.0% 4.74sec 781888 300.94sec
Ðepeche Ðepeche divine_storm 53385 394943 1312 3.21 19830 41219 16.1 16.1 14.8% 0.0% 0.0% 0.0% 17.49sec 394943 300.94sec
Ðepeche Ðepeche draenic_strength_potion 156428 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.94sec
Ðepeche Ðepeche execution_sentence ticks -114157 370690 1236 10.73 5376 11868 5.5 53.7 17.0% 0.0% 0.0% 0.0% 60.46sec 370690 300.94sec
Ðepeche Ðepeche exorcism 879 103133 343 1.93 8844 17688 9.7 9.7 12.7% 0.0% 0.0% 0.0% 16.26sec 103133 300.94sec
Ðepeche Ðepeche final_verdict 157048 1343614 4465 10.55 20475 42610 52.9 52.9 15.0% 0.0% 0.0% 0.0% 5.65sec 1343614 300.94sec
Ðepeche Ðepeche hammer_of_wrath 24275 1108454 3683 10.55 16474 34250 52.9 52.9 17.8% 0.0% 0.0% 0.0% 5.73sec 1108454 300.94sec
Ðepeche Ðepeche hand_of_light 96172 1791726 5954 45.15 7911 0 226.5 226.5 0.0% 0.0% 0.0% 0.0% 1.62sec 1791726 300.94sec
Ðepeche Ðepeche judgment 20271 347581 1155 6.90 8348 16707 34.6 34.6 12.7% 0.0% 0.0% 0.0% 7.72sec 347581 300.94sec
Ðepeche Ðepeche melee 0 734411 2440 19.89 5936 12365 99.7 99.7 15.0% 0.0% 0.0% 0.0% 3.01sec 1128673 300.94sec
Ðepeche Ðepeche rebuke 96231 0 0 1.68 0 0 8.4 8.4 0.0% 0.0% 0.0% 0.0% 37.56sec 0 300.94sec
Ðepeche Ðepeche seal_of_truth_proc 31801 415924 1382 60.52 1102 2299 303.5 303.5 15.2% 0.0% 0.0% 0.0% 0.99sec 415924 300.94sec
Ðepeche Ðepeche shattered_bleed 159238 36031 120 3.53 1653 3376 17.7 17.7 14.9% 0.0% 0.0% 0.0% 17.37sec 117940 300.94sec
Ðepeche Ðepeche shattered_bleed ticks -159238 81908 273 19.75 777 0 17.7 98.7 0.0% 0.0% 0.0% 0.0% 17.37sec 117940 300.94sec
Swæty Swæty devouring_plague 2944 653187 2171 4.25 24160 48327 21.3 21.3 18.8% 0.0% 0.0% 0.0% 13.56sec 653187 300.94sec
Swæty Swæty devouring_plague_tick ticks -2944 640760 2136 25.99 4105 0 26.1 130.0 0.0% 0.0% 0.0% 0.0% 10.95sec 0 300.94sec
Swæty Swæty draenic_intellect_potion 156426 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.94sec
Swæty Swæty halo 120644 0 0 1.36 0 0 6.8 6.8 18.8% 0.0% 0.0% 0.0% 46.76sec 0 300.94sec
Swæty Swæty halo_damage 120696 226694 753 1.36 26156 52361 6.8 6.8 18.8% 0.0% 0.0% 0.0% 46.76sec 226694 300.94sec
Swæty Swæty insanity ticks -129197 979822 3266 18.75 8242 16485 34.8 93.7 18.8% 0.0% 0.0% 0.0% 7.96sec 979822 300.94sec
Swæty Swæty mind_blast 8092 1775686 5901 11.09 25166 50320 55.6 55.6 18.9% 0.0% 0.0% 0.0% 5.46sec 1775686 300.94sec
Swæty Swæty mind_spike 73510 1413651 4698 13.97 15913 31825 70.0 70.0 18.8% 0.0% 0.0% 0.0% 4.20sec 1413651 300.94sec
Swæty Swæty shadow_word_death 32379 481782 1601 2.26 33468 66967 11.4 11.4 18.7% 0.0% 0.0% 0.0% 5.38sec 481791 300.94sec
Swæty Swæty shadow_word_pain 589 33387 111 1.44 3659 7315 7.2 7.2 18.7% 0.0% 0.0% 0.0% 32.82sec 251151 300.94sec
Swæty Swæty shadow_word_pain ticks -589 217764 726 9.99 3428 6855 7.2 50.0 18.7% 0.0% 0.0% 0.0% 32.82sec 251151 300.94sec
Swæty Swæty shadowy_apparitions 78203 40298 134 1.87 3392 6783 9.4 9.4 18.7% 0.0% 0.0% 0.0% 22.61sec 40298 300.94sec
Swæty Swæty shadowfiend 34433 0 0 0.41 0 0 2.0 2.0 18.7% 0.0% 0.0% 0.0% 180.87sec 0 300.94sec
Swæty Swæty shadowform 15473 0 0 0.20 0 0 1.0 1.0 18.4% 0.0% 0.0% 0.0% 0.00sec 0 300.94sec
Swæty Swæty shattered_bleed 159238 36104 120 3.39 1676 3352 17.0 17.0 18.7% 0.0% 0.0% 0.0% 18.05sec 116895 300.94sec
Swæty Swæty shattered_bleed ticks -159238 80791 269 19.16 789 0 17.0 95.8 0.0% 0.0% 0.0% 0.0% 18.05sec 116895 300.94sec
Swæty Swæty vampiric_touch ticks -34914 223431 745 8.51 4123 8248 7.2 42.5 18.8% 0.0% 0.0% 0.0% 32.97sec 223431 300.94sec
Swæty Swæty_shadowfiend melee 0 140727 5841 49.90 5534 11070 20.0 20.0 18.8% 0.0% 0.0% 0.0% 10.28sec 140727 24.09sec
Swæty Swæty_shadowfiend shadowcrawl 63619 0 0 15.04 0 0 6.0 6.0 18.7% 0.0% 0.0% 0.0% 39.63sec 0 24.09sec
Ralana Ralana adrenaline_rush 13750 0 0 0.77 0 0 3.9 3.9 0.0% 0.0% 0.0% 0.0% 86.39sec 0 300.94sec
Ralana Ralana ambush 8676 137742 458 1.41 15105 30179 7.1 7.1 22.7% 0.0% 0.0% 0.0% 48.65sec 211687 300.94sec
Ralana Ralana auto_attack_mh 0 1402833 4662 43.03 5054 10107 215.8 215.8 22.7% 0.0% 0.0% 0.0% 1.40sec 2155933 300.94sec
Ralana Ralana auto_attack_oh 1 688875 2289 42.29 2524 5049 212.1 212.1 22.7% 0.0% 0.0% 0.0% 1.42sec 1058692 300.94sec
Ralana Ralana draenic_agility_potion 156423 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.94sec
Ralana Ralana eviscerate 2098 1019906 3389 7.14 22148 44304 35.8 35.8 22.6% 0.0% 0.0% 0.0% 8.02sec 1567435 300.94sec
Ralana Ralana instant_poison 157607 632511 2102 41.47 2364 4728 208.0 208.0 22.6% 0.0% 0.0% 0.0% 1.47sec 632511 300.94sec
Ralana Ralana kick 1766 0 0 1.66 0 0 8.3 8.3 0.0% 0.0% 0.0% 0.0% 37.80sec 0 300.94sec
Ralana Ralana killing_spree 51690 0 0 1.14 0 0 5.7 5.7 0.0% 0.0% 0.0% 0.0% 57.11sec 0 300.94sec
Ralana Ralana killing_spree_mh ticks -57841 255231 851 0.00 4851 9702 39.9 0.0 22.7% 0.0% 0.0% 0.0% 7.02sec 382729 300.94sec
Ralana Ralana killing_spree_oh ticks -57842 127600 425 0.00 2425 4852 39.9 0.0 22.7% 0.0% 0.0% 0.0% 7.02sec 191336 300.94sec
Ralana Ralana main_gauche 86392 937901 3117 42.81 3396 6793 214.7 214.7 22.6% 0.0% 0.0% 0.0% 1.47sec 1441406 300.94sec
Ralana Ralana preparation 14185 0 0 0.24 0 0 1.2 1.2 0.0% 0.0% 0.0% 0.0% 313.12sec 0 300.94sec
Ralana Ralana revealing_strike 84617 93826 312 2.53 5737 11478 12.7 12.7 22.8% 0.0% 0.0% 0.0% 24.25sec 1194006 300.94sec
Ralana Ralana sinister_strike 1752 1256392 4175 25.95 7505 15012 130.1 130.1 22.7% 0.0% 0.0% 0.0% 2.27sec 1930876 300.94sec
Ralana Ralana slice_and_dice 5171 0 0 1.95 0 0 9.8 9.8 0.0% 0.0% 0.0% 0.0% 32.11sec 0 300.94sec
Ralana Ralana vanish 1856 0 0 1.22 0 0 6.1 6.1 0.0% 0.0% 0.0% 0.0% 48.64sec 0 300.94sec
Mîrai Mîrai ambush 8676 927715 3083 6.18 19959 42941 31.0 31.0 26.5% 0.0% 0.0% 0.0% 9.50sec 1004812 300.94sec
Mîrai Mîrai auto_attack_mh 0 1534285 5098 62.65 3939 8558 314.2 314.2 24.4% 19.0% 0.0% 0.0% 0.96sec 1819037 300.94sec
Mîrai Mîrai auto_attack_oh 1 737399 2450 62.11 1908 4153 311.5 311.5 24.4% 19.0% 0.0% 0.0% 0.97sec 874357 300.94sec
Mîrai Mîrai backstab 53 893962 2971 16.47 7509 16072 82.6 82.6 23.5% 0.0% 0.0% 0.0% 3.48sec 1112392 300.94sec
Mîrai Mîrai deadly_poison_dot ticks -2818 279645 932 19.89 1945 4120 196.3 99.5 24.2% 0.0% 0.0% 0.0% 1.53sec 279645 300.94sec
Mîrai Mîrai deadly_poison_instant 113780 285921 950 38.93 1011 2148 195.3 195.3 24.3% 0.0% 0.0% 0.0% 1.53sec 285921 300.94sec
Mîrai Mîrai draenic_agility_potion 156423 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.94sec
Mîrai Mîrai eviscerate 2098 1443163 4796 6.69 29348 64022 33.6 33.6 24.4% 0.0% 0.0% 0.0% 8.82sec 1651982 300.94sec
Mîrai Mîrai garrote ticks -703 12880 43 1.80 936 1916 1.0 9.0 33.0% 0.0% 0.0% 0.0% 0.00sec 12880 300.94sec
Mîrai Mîrai kick 1766 0 0 1.68 0 0 8.4 8.4 0.0% 0.0% 0.0% 0.0% 37.57sec 0 300.94sec
Mîrai Mîrai premeditation 14183 0 0 1.75 0 0 8.8 8.8 0.0% 0.0% 0.0% 0.0% 37.11sec 0 300.94sec
Mîrai Mîrai preparation 14185 0 0 0.23 0 0 1.2 1.2 0.0% 0.0% 0.0% 0.0% 313.02sec 0 300.94sec
Mîrai Mîrai rupture ticks -1943 1394147 4647 39.41 4896 10377 17.1 197.0 24.2% 0.0% 0.0% 0.0% 17.93sec 1394147 300.94sec
Mîrai Mîrai shadow_dance 51713 0 0 1.06 0 0 5.3 5.3 0.0% 0.0% 0.0% 0.0% 61.81sec 0 300.94sec
Mîrai Mîrai shadow_reflection 152151 0 0 0.57 0 0 2.9 2.9 0.0% 0.0% 0.0% 0.0% 124.05sec 0 300.94sec
Mîrai Mîrai shattered_bleed 159238 39625 132 3.34 1662 3395 16.7 16.7 24.2% 0.0% 0.0% 0.0% 18.35sec 124076 300.94sec
Mîrai Mîrai shattered_bleed ticks -159238 84452 282 18.61 797 0 16.7 93.1 0.0% 0.0% 0.0% 0.0% 18.35sec 124076 300.94sec
Mîrai Mîrai slice_and_dice 5171 0 0 1.76 0 0 8.8 8.8 0.0% 0.0% 0.0% 0.0% 36.21sec 0 300.94sec
Mîrai Mîrai vanish 1856 0 0 0.83 0 0 4.2 4.2 0.0% 0.0% 0.0% 0.0% 72.45sec 0 300.94sec
Mîrai Mîrai_shadow_reflection ambush 8676 194167 4317 14.09 12185 24656 10.6 10.6 31.9% 0.0% 0.0% 0.0% 24.05sec 298405 44.98sec
Mîrai Mîrai_shadow_reflection backstab 53 875 19 0.13 5894 11966 0.1 0.1 30.3% 0.0% 0.0% 0.0% 67.99sec 1344 44.98sec
Mîrai Mîrai_shadow_reflection eviscerate 2098 114007 2535 3.83 26322 53424 2.9 2.9 31.5% 0.0% 0.0% 0.0% 98.67sec 175211 44.98sec
Mîrai Mîrai_shadow_reflection rupture ticks -1943 141724 472 4.83 4041 8495 2.1 24.1 25.2% 0.0% 0.0% 0.0% 145.22sec 141724 44.98sec
Shaerlyn Shaerlyn ascendance 165339 0 0 0.40 0 0 2.0 2.0 15.6% 0.0% 0.0% 0.0% 181.24sec 0 300.94sec
Shaerlyn Shaerlyn draenic_intellect_potion 156426 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.94sec
Shaerlyn Shaerlyn earth_shock 8042 272515 906 3.23 9939 24834 16.2 16.2 15.6% 0.0% 0.0% 0.0% 18.18sec 272515 300.94sec
Shaerlyn Shaerlyn fulmination 88766 740264 2460 3.23 26980 67432 16.2 16.2 15.6% 0.0% 0.0% 0.0% 18.18sec 740264 300.94sec
Shaerlyn Shaerlyn elemental_mastery 16166 0 0 0.60 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 121.14sec 0 300.94sec
Shaerlyn Shaerlyn fire_elemental_totem 2894 0 0 0.30 0 0 1.5 1.5 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.94sec
Shaerlyn Shaerlyn flame_shock 8050 75870 252 2.14 4198 10496 10.7 10.7 15.5% 0.0% 0.0% 0.0% 29.19sec 524279 300.94sec
Shaerlyn Shaerlyn flame_shock ticks -8050 448409 1495 24.71 2144 5361 10.7 123.6 15.6% 0.0% 0.0% 0.0% 29.19sec 524279 300.94sec
Shaerlyn Shaerlyn lava_burst 51505 3052039 10142 11.93 0 35264 59.9 59.8 100.0% 0.0% 0.0% 0.0% 4.97sec 3052039 300.94sec
Shaerlyn Shaerlyn lightning_bolt 403 2009251 6677 18.84 12613 31523 94.8 94.5 15.6% 0.0% 0.0% 0.0% 2.94sec 2009251 300.94sec
Shaerlyn Shaerlyn lightning_shield 324 0 0 0.20 0 0 1.0 1.0 15.4% 0.0% 0.0% 0.0% 0.00sec 0 300.94sec
Shaerlyn Shaerlyn molten_earth 170379 1287467 4278 24.72 6145 15368 124.5 124.0 15.6% 0.0% 0.0% 0.0% 2.40sec 1287467 300.94sec
Shaerlyn Shaerlyn searing_totem 3599 0 0 0.77 0 0 3.9 3.9 0.0% 0.0% 0.0% 0.0% 65.98sec 0 300.94sec
Shaerlyn Shaerlyn unleash_flame 165462 0 0 3.69 0 0 18.5 18.5 0.0% 0.0% 0.0% 0.0% 16.68sec 0 300.94sec
Shaerlyn Shaerlyn wind_shear 57994 0 0 1.68 0 0 8.4 8.4 0.0% 0.0% 0.0% 0.0% 37.62sec 0 300.94sec
Shaerlyn Shaerlyn_greater_fire_elemental fire_blast 57984 15833 206 9.91 792 1982 12.7 12.7 15.5% 0.0% 0.0% 0.0% 15.54sec 15833 76.91sec
Shaerlyn Shaerlyn_greater_fire_elemental melee 0 202337 2631 56.39 1778 4446 72.3 72.3 15.6% 0.0% 0.0% 0.0% 2.58sec 202337 76.91sec
Shaerlyn Shaerlyn_searing_totem searing_bolt 3606 251715 1215 34.95 1329 3323 121.0 120.7 15.5% 0.0% 0.0% 0.0% 1.85sec 251715 207.16sec
Candylicious Candylicious chaos_bolt 116858 1720533 5717 4.90 0 62584 24.8 24.6 100.0% 0.0% 0.0% 0.0% 12.02sec 1720533 300.94sec
Candylicious Candylicious conflagrate 17962 617130 2051 5.26 16171 33108 26.4 26.4 28.0% 0.0% 0.0% 0.0% 11.57sec 617130 300.94sec
Candylicious Candylicious dark_soul 113858 0 0 0.60 0 0 3.0 3.0 21.3% 0.0% 0.0% 0.0% 120.79sec 0 300.94sec
Candylicious Candylicious draenic_intellect_potion 156426 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.94sec
Candylicious Candylicious immolate 348 229920 764 4.11 7822 15990 20.6 20.6 26.4% 0.0% 0.0% 0.0% 14.90sec 908011 300.94sec
Candylicious Candylicious immolate ticks -348 678092 2260 24.48 3891 7916 20.6 122.4 26.3% 0.0% 0.0% 0.0% 14.90sec 908011 300.94sec
Candylicious Candylicious incinerate 29722 2192079 7284 27.51 11303 22986 138.9 138.0 24.8% 0.0% 0.0% 0.0% 2.16sec 2192079 300.94sec
Candylicious Candylicious summon_terrorguard 112927 0 0 0.40 0 0 1.0 2.0 18.2% 0.0% 0.0% 0.0% 0.00sec 0 300.94sec
Candylicious Candylicious_terrorguard doom_bolt 85692 2070776 6881 21.16 13668 27774 106.8 106.1 26.7% 0.0% 0.0% 0.0% 2.81sec 2070776 300.94sec
Dârkride Dârkride auto_attack_mh 0 740071 2459 26.58 4466 9036 133.3 133.3 19.0% 0.0% 0.0% 0.0% 2.27sec 1137372 300.94sec
Dârkride Dârkride berserker_rage 18499 0 0 1.82 0 0 9.1 9.1 0.0% 0.0% 0.0% 0.0% 34.55sec 0 300.94sec
Dârkride Dârkride blood_craze 159362 0 0 0.00 0 0 17.8 0.0 0.0% 0.0% 0.0% 0.0% 16.12sec 137177 300.94sec
Dârkride Dârkride bloodbath ticks -113344 379260 1264 18.44 4114 0 5.5 92.2 0.0% 0.0% 0.0% 0.0% 60.04sec 379260 300.94sec
Dârkride Dârkride charge 100 0 0 0.20 0 0 1.0 1.0 16.5% 0.0% 0.0% 0.0% 0.00sec 0 300.94sec
Dârkride Dârkride deep_wounds ticks -115767 590248 1967 19.73 4828 9737 120.9 98.7 18.8% 0.0% 0.0% 0.0% 2.47sec 590248 300.94sec
Dârkride Dârkride devastate 20243 1312799 4362 24.10 8732 17702 120.9 120.9 19.1% 0.0% 0.0% 0.0% 2.47sec 2017565 300.94sec
Dârkride Dârkride draenic_armor_potion 156430 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.94sec
Dârkride Dârkride dragon_roar 118000 160562 534 1.07 0 28755 5.4 5.4 100.0% 0.0% 0.0% 0.0% 61.14sec 160562 300.94sec
Dârkride Dârkride execute 5308 202377 672 1.29 25404 50860 6.5 6.5 18.5% 0.0% 0.0% 0.0% 7.91sec 311021 300.94sec
Dârkride Dârkride heroic_leap 6544 23507 78 1.37 2729 5632 6.9 6.9 19.5% 0.0% 0.0% 0.0% 46.05sec 36127 300.94sec
Dârkride Dârkride heroic_strike 78 1218937 4050 37.36 4978 10190 187.4 187.4 24.5% 0.0% 0.0% 0.0% 1.61sec 1873313 300.94sec
Dârkride Dârkride revenge 6572 561620 1866 6.02 15000 30280 30.2 30.2 18.9% 0.0% 0.0% 0.0% 10.09sec 863121 300.94sec
Dârkride Dârkride shattered_bleed 159238 43681 145 3.39 2077 4161 17.0 17.0 19.0% 0.0% 0.0% 0.0% 17.97sec 123459 300.94sec
Dârkride Dârkride shattered_bleed ticks -159238 79777 266 19.26 796 0 17.0 96.3 0.0% 0.0% 0.0% 0.0% 17.97sec 123459 300.94sec
Dârkride Dârkride shield_charge 156321 0 0 4.24 0 0 21.3 21.3 0.0% 0.0% 0.0% 0.0% 14.53sec 0 300.94sec
Dârkride Dârkride shield_slam 23922 1368332 4547 13.34 16427 33372 66.9 66.9 19.1% 0.0% 0.0% 0.0% 4.52sec 2102910 300.94sec

Fluffy_Pillow : 32435 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
32435.0 32435.0 22.9 / 0.071% 7229.7 / 22.3% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 82.96% 5.5 100.0% 100%

Charts

http://7.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Fluffy_Pillow+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x150&chd=t:167209|37733|23990|23495&chds=0,334417&chco=C41F3B,C79C6E,C41F3B,C79C6E&chm=t++167209++spell_dot_Zambo,C41F3B,0,0,15|t++37733++melee_nuke_Zambo,C79C6E,1,0,15|t++23990++spell_nuke_Zambo,C41F3B,2,0,15|t++23495++melee_main_hand_Zambo,C79C6E,3,0,15& http://8.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Fluffy_Pillow+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:68,20,8,4&chds=0,100&chdls=ffffff&chco=C79C6E,C41F3B,C79C6E,C41F3B&chl=melee_main_hand_Zambo|spell_dot_Zambo|melee_nuke_Zambo|spell_nuke_Zambo& DPS Taken Timeline Chart
http://0.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Fluffy_Pillow+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:OORRXXaaggkkppsrsqoollkkhhmmkkiihhkkmmqqssvvxxvvyy00zzyy11yywwttqqnnkkkkjjikfhhjkllmntvwwyxz02311zzxxwwvvplopnmlljoopprruuwwyy50225577443311zzxx00xxvvssqqoonpprruuwqstvvxyzz55664310xuutrpnljhhgZYXYZabdeinopqrtvxz02355442y12vututsqpousrpooqqvrttwwyy0033zz11443327552200yywwuussppqqsnppssuuwwy4556666442200xxvvttsmkkjjjjikrsrsstuvvxxzw33557860zzyyxwvvyzwztsqrpopopqqmmjjgaWWTT&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.749096,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=374|1:|0|avg=32435|max=43299&chxp=1,1,75,100 http://3.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Fluffy_Pillow+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:4,2,5,7,9,14,22,39,60,61,127,149,216,278,374,461,555,698,817,957,1161,1236,1334,1407,1466,1542,1493,1480,1393,1308,1251,1032,889,701,624,526,365,270,192,155,97,90,53,40,18,11,4,3,3,1&chds=0,1542&chbh=5&chxt=x&chxl=0:|min=25184|avg=32435|max=39350&chxp=0,1,51,100& http://9.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Fluffy_Pillow+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:7.0,5.6,3.9,83.0&chds=0,100&chdls=ffffff&chco=C79C6E,C41F3B,C41F3B,ffffff&chl=melee_nuke_Zambo 21.1s|spell_nuke_Zambo 16.8s|spell_dot_Zambo 11.8s|waiting 249.6s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% B% Up%
Fluffy_Pillow 32435
melee_main_hand_Zambo 21915 67.6% 140.6 2.11sec 46990 23495 Direct 140.6 59111 0 46990 0.0% 20.5% 33.2%  

Stats details: melee_main_hand_Zambo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 140.59 140.59 0.00 0.00 2.0000 0.0000 6606183.57 24585454.76 73.13 23495.25 23495.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.05 46.27% 73049.40 0 133224 72911.01 56295 88770 4751722 14309755 66.86
hit (blocked) 46.71 33.23% 39700.58 0 79934 39630.15 25633 52352 1854462 10275700 81.99
parry 28.13 20.01% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 0.70 0.49% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: melee_main_hand_Zambo

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Zambo
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:198000.00
  • base_dd_max:242000.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
melee_nuke_Zambo 2637 8.1% 10.5 29.35sec 75633 37733 Direct 10.5 75633 0 75633 0.0% 0.0% 41.7%  

Stats details: melee_nuke_Zambo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.50 10.50 0.00 0.00 2.0045 0.0000 794466.59 2731263.90 70.91 37732.92 37732.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.12 58.31% 91776.51 0 157447 91688.70 0 156829 562098 1592467 64.73
hit (blocked) 4.38 41.69% 53057.45 0 94467 52783.87 0 94386 232369 1138796 79.29
 
DPS Timeline Chart
 

Action details: melee_nuke_Zambo

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:27.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Zambo
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:234000.00
  • base_dd_max:286000.00
 
spell_dot_Zambo 6547 20.2% 7.8 40.66sec 251552 167209 Periodic 75.7 26027 0 26027 0.0% 0.0% 0.0% 50.3%

Stats details: spell_dot_Zambo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.83 7.83 75.71 75.71 1.5045 2.0000 1970554.55 3785668.00 47.95 12073.59 167208.70
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.83 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.7 100.00% 26026.58 0 42772 26016.29 20077 31109 1970555 3785668 47.97
 
DPS Timeline Chart
 

Action details: spell_dot_Zambo

Static Values
  • id:0
  • school:fire
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:40.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zambo
  • harmful:true
  • if_expr:!ticking
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:50000.00
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
spell_nuke_Zambo 1336 4.1% 8.4 37.58sec 48086 23990 Direct 8.4 48087 0 48087 0.0% 0.0% 0.0%  

Stats details: spell_nuke_Zambo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.38 8.38 0.00 0.00 2.0045 0.0000 402843.37 921563.97 56.29 23990.20 23990.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.38 100.00% 48086.53 0 103507 47958.48 18633 74682 402843 921564 56.41
 
DPS Timeline Chart
 

Action details: spell_nuke_Zambo

Static Values
  • id:0
  • school:fire
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:35.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Zambo
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:99000.00
  • base_dd_max:121000.00
 
Simple Action Stats Execute Interval
Fluffy_Pillow

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 10.20% 10.21% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:10.20%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 10.25% 10.27% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:10.25%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.50% 10.52% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.50%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 11.14% 11.16% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:11.14%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.65% 10.66% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.65%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.65% 10.67% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.65%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 11.63% 11.64% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:11.63%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.34% 11.35% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.34%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 8.13% 8.14% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:8.13%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 5.51% 5.51% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:5.51%

Trigger Attempt Success

  • trigger_pct:100.00%
censure 1.0 302.5 0.0sec 1.0sec 99.56% 100.00% 298.5(298.5)

Buff details

  • buff initial source:Ðepeche
  • cooldown name:buff_censure
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • censure_1:0.34%
  • censure_2:0.11%
  • censure_3:0.23%
  • censure_4:0.34%
  • censure_5:98.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31803
  • name:Censure
  • tooltip:Holy damage every $t1 sec.
  • description:Deals $m1 additional Holy damage over {$31803d=15 seconds}. Stacks up to {$31803u=5} times.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
find_weakness 9.5 22.5 33.1sec 9.5sec 48.04% 48.05% 22.5(22.5)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_find_weakness
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

  • find_weakness_1:48.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:91021
  • name:Find Weakness
  • tooltip:$w1% of armor is ignored by the attacking Rogue.
  • description:Your Ambush, Garrote, and Cheap Shot abilities reveal a flaw in your target's defenses, causing all your attacks to bypass a portion of that enemy's armor for {$91021d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
water_jet 10.0 0.0 30.4sec 30.4sec 11.51% 17.44% 0.0(0.0)

Buff details

  • buff initial source:Procrank_water_elemental
  • cooldown name:buff_water_jet
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • water_jet_1:11.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:135029
  • name:Water Jet
  • tooltip:Taking $s1 damage every $t1 sec. Frostbolts from the Water Elemental's owner that hit the target will grant a charge of Fingers of Frost.
  • description:Channels a jet of icy water at the target, dealing $o1 Frost damage to the target over {$d=4 seconds}. The Mage's Frostbolts that hit the target while it is being blasted with icy water will grant a charge of Fingers of Frost.
  • max_stacks:0
  • duration:4.00
  • cooldown:25.00
  • default_chance:0.00%
water_jet 10.0 0.0 30.4sec 30.4sec 11.31% 16.76% 0.0(0.0)

Buff details

  • buff initial source:Zentimeter_water_elemental
  • cooldown name:buff_water_jet
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • water_jet_1:11.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:135029
  • name:Water Jet
  • tooltip:Taking $s1 damage every $t1 sec. Frostbolts from the Water Elemental's owner that hit the target will grant a charge of Fingers of Frost.
  • description:Channels a jet of icy water at the target, dealing $o1 Frost damage to the target over {$d=4 seconds}. The Mage's Frostbolts that hit the target while it is being blasted with icy water will grant a charge of Fingers of Frost.
  • max_stacks:0
  • duration:4.00
  • cooldown:25.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bleeding_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
mortal_wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 349492.79
Combat End Resource Mean Min Max
Health 0.00 0.00 0.00
Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Deaths

death count 34239
death count pct 136.93
avg death time 300.57
min death time 230.43
max death time 374.11
dmg taken 105184487.35

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 25000
Mean 300.94
Minimum 230.43
Maximum 374.11
Spread ( max - min ) 143.68
Range [ ( max - min ) / 2 * 100% ] 23.87%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 25000
Mean 32435.01
Minimum 25184.44
Maximum 39350.09
Spread ( max - min ) 14165.65
Range [ ( max - min ) / 2 * 100% ] 21.84%
Standard Deviation 1847.4725
5th Percentile 29350.75
95th Percentile 35419.05
( 95th Percentile - 5th Percentile ) 6068.31
Mean Distribution
Standard Deviation 11.6844
95.00% Confidence Intervall ( 32412.10 - 32457.91 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 124
0.1% Error 12463
0.1 Scale Factor Error with Delta=300 29136
0.05 Scale Factor Error with Delta=300 116546
0.01 Scale Factor Error with Delta=300 2913665
Distribution Chart
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 25000
Mean 32435.01
Minimum 25184.44
Maximum 39350.09
Spread ( max - min ) 14165.65
Range [ ( max - min ) / 2 * 100% ] 21.84%
Damage
Sample Data Fluffy_Pillow Damage
Count 25000
Mean 9774048.08
Minimum 5811036.11
Maximum 13983093.38
Spread ( max - min ) 8172057.27
Range [ ( max - min ) / 2 * 100% ] 41.80%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 25000
Mean 350230.03
Minimum 333982.65
Maximum 367826.01
Spread ( max - min ) 33843.36
Range [ ( max - min ) / 2 * 100% ] 4.83%
Standard Deviation 5946.6766
5th Percentile 340528.42
95th Percentile 358898.36
( 95th Percentile - 5th Percentile ) 18369.94
Mean Distribution
Standard Deviation 37.6101
95.00% Confidence Intervall ( 350156.32 - 350303.75 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 11
0.1% Error 1107
0.1 Scale Factor Error with Delta=300 301878
0.05 Scale Factor Error with Delta=300 1207514
0.01 Scale Factor Error with Delta=300 30187858
Distribution Chart
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 6213
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats
Default action list Executed every time the actor is available.
# count action,conditions
1 1.00 auto_attack,damage=220000,attack_speed=2,aoe_tanks=1
2 7.83 spell_dot,damage=50000,tick_time=2,dot_duration=20,cooldown=40,aoe_tanks=1,if=!ticking
3 8.42 spell_nuke,damage=110000,cooldown=35,attack_speed=2,aoe_tanks=1
4 10.57 melee_nuke,damage=260000,cooldown=27,attack_speed=2,aoe_tanks=1

Sample Sequence

123443243243424324324342342

Sample Sequence Table

time name target resources buffs
0:00.000 auto_attack_Zambo Zambo 103873879.7/103910023: 100% health
0:02.000 spell_dot_Zambo Zambo 103202956.6/103910023: 99% health find_weakness, censure
0:03.505 spell_nuke_Zambo Zambo 102432887.1/103910023: 99% health find_weakness, censure(4)
0:05.510 melee_nuke_Zambo Zambo 101219300.3/103910023: 97% health find_weakness, censure(5)
0:07.515 Waiting 27.000 sec 99963373.0/103910023: 96% health find_weakness, censure(5)
0:34.515 melee_nuke_Zambo Zambo 85066416.0/103910023: 82% health Health Decade (80 - 90), find_weakness, censure(5)
0:36.519 Waiting 4.000 sec 84361662.4/103910023: 81% health Health Decade (80 - 90), find_weakness, censure(5)
0:40.519 spell_nuke_Zambo Zambo 82789204.2/103910023: 80% health Health Decade (70 - 80), censure(5), water_jet
0:42.523 spell_dot_Zambo Zambo 82105437.2/103910023: 79% health Health Decade (70 - 80), censure(5), water_jet, water_jet
0:44.026 Waiting 20.000 sec 81617556.6/103910023: 79% health Health Decade (70 - 80), censure(5)
1:04.026 melee_nuke_Zambo Zambo 75972895.3/103910023: 73% health Health Decade (70 - 80), find_weakness, censure(5)
1:06.033 Waiting 12.000 sec 75285907.4/103910023: 72% health Health Decade (70 - 80), find_weakness, censure(5)
1:18.033 spell_nuke_Zambo Zambo 71421781.0/103910023: 69% health Health Decade (60 - 70), find_weakness, censure(5)
1:20.036 Waiting 3.000 sec 70806457.0/103910023: 68% health Health Decade (60 - 70), censure(5)
1:23.036 spell_dot_Zambo Zambo 70147593.5/103910023: 68% health Health Decade (60 - 70), censure(5)
1:24.542 Waiting 9.000 sec 69641385.0/103910023: 67% health Health Decade (60 - 70), censure(5)
1:33.542 melee_nuke_Zambo Zambo 67258379.9/103910023: 65% health Health Decade (60 - 70), censure(5)
1:35.545 Waiting 20.000 sec 66612689.8/103910023: 64% health Health Decade (60 - 70), censure(5)
1:55.545 spell_nuke_Zambo Zambo 60821963.9/103910023: 59% health Health Decade (50 - 60), censure(5)
1:57.550 Waiting 5.000 sec 60264772.2/103910023: 58% health Health Decade (50 - 60), censure(5)
2:02.550 melee_nuke_Zambo Zambo 58915205.9/103910023: 57% health Health Decade (50 - 60), find_weakness, censure(5)
2:04.555 spell_dot_Zambo Zambo 58210206.8/103910023: 56% health Health Decade (50 - 60), find_weakness, censure(5)
2:06.059 Waiting 26.000 sec 57762791.1/103910023: 56% health Health Decade (50 - 60), find_weakness, censure(5)
2:32.059 melee_nuke_Zambo Zambo 47583703.6/103910023: 46% health Health Decade (40 - 50), find_weakness, censure(5)
2:34.064 spell_nuke_Zambo Zambo 46987296.8/103910023: 45% health Health Decade (40 - 50), find_weakness, censure(5)
2:36.068 Waiting 9.000 sec 46412163.9/103910023: 45% health Health Decade (40 - 50), find_weakness, censure(5)
2:45.068 spell_dot_Zambo Zambo 43952096.1/103910023: 42% health Health Decade (40 - 50), censure(5)
2:46.574 Waiting 15.000 sec 43583815.0/103910023: 42% health Health Decade (40 - 50), censure(5)
3:01.574 melee_nuke_Zambo Zambo 39520741.6/103910023: 38% health Health Decade (30 - 40), censure(5)
3:03.577 Waiting 8.000 sec 38997764.5/103910023: 38% health Health Decade (30 - 40), find_weakness, censure(5)
3:11.577 spell_nuke_Zambo Zambo 36165058.0/103910023: 35% health Health Decade (30 - 40), find_weakness, censure(5)
3:13.580 Waiting 12.000 sec 35247812.8/103910023: 34% health Health Decade (30 - 40), find_weakness, censure(5)
3:25.580 spell_dot_Zambo Zambo 30819708.7/103910023: 30% health Health Decade (20 - 30), censure(5)
3:27.084 Waiting 4.000 sec 30372481.3/103910023: 29% health Health Decade (20 - 30), censure(5)
3:31.084 melee_nuke_Zambo Zambo 29217453.8/103910023: 28% health Health Decade (20 - 30), censure(5)
3:33.088 Waiting 16.000 sec 28726866.2/103910023: 28% health Health Decade (20 - 30), censure(5)
3:49.088 spell_nuke_Zambo Zambo 23655947.9/103910023: 23% health Health Decade (20 - 30), censure(5)
3:51.091 Waiting 9.000 sec 23004184.7/103910023: 22% health Health Decade (20 - 30), censure(5)
4:00.091 melee_nuke_Zambo Zambo 20198721.5/103910023: 19% health Health Decade (10 - 20), find_weakness, censure(5)
4:02.096 Waiting 4.000 sec 19572280.7/103910023: 19% health Health Decade (10 - 20), find_weakness, censure(5)
4:06.096 spell_dot_Zambo Zambo 18418032.7/103910023: 18% health Health Decade (10 - 20), find_weakness, censure(5)
4:07.601 Waiting 19.000 sec 17802569.5/103910023: 17% health Health Decade (10 - 20), find_weakness, censure(5)
4:26.601 spell_nuke_Zambo Zambo 9756436.7/103910023: 9% health Health Decade (0 - 10), find_weakness, censure(5)
4:28.607 Waiting 1.000 sec 9052379.3/103910023: 9% health Health Decade (0 - 10), find_weakness, censure(5)
4:29.607 melee_nuke_Zambo Zambo 8754332.3/103910023: 8% health Health Decade (0 - 10), censure(5)
4:31.612 Waiting 15.000 sec 8078854.0/103910023: 8% health Health Decade (0 - 10), censure(5)
4:46.612 spell_dot_Zambo Zambo 2806299.0/103910023: 3% health Health Decade (0 - 10), censure(5)
4:48.116 Waiting 8.000 sec 2343703.3/103910023: 2% health Health Decade (0 - 10), censure(5)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 125924313 0
Melee Crit 0.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste INF% 0.00% 0
Multistrike 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 0 1938 1938
Tank-Miss 0.00% 3.00% 0
Tank-Dodge 0.00% 3.00% 0
Tank-Parry 0.00% 3.00% 0
Tank-Block 0.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00
Head empty
Neck empty
Shoulders empty
Shirt empty
Chest empty
Waist empty
Legs empty
Feet empty
Wrists empty
Hands empty
Finger1 empty
Finger2 empty
Trinket1 empty
Trinket2 empty
Back empty
Main Hand empty
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
level=103
race=humanoid
role=tank
position=front
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=snapshot_stats

# Executed every time the actor is available.

actions=auto_attack,damage=220000,attack_speed=2,aoe_tanks=1
actions+=/spell_dot,damage=50000,tick_time=2,dot_duration=20,cooldown=40,aoe_tanks=1,if=!ticking
actions+=/spell_nuke,damage=110000,cooldown=35,attack_speed=2,aoe_tanks=1
actions+=/melee_nuke,damage=260000,cooldown=27,attack_speed=2,aoe_tanks=1


# Gear Summary

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Max Spike Damage Frequency

This is roughly how many spikes as large as MSD Mean you take per iteration. Calculated from TMI and MSD values.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.